SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002385 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002385
Domain Number 1 Region: 7-114
Classification Level Classification E-value
Superfamily eIF1-like 1.44e-39
Family eIF1-like 0.000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002385   Gene: ENSLAFG00000002852   Transcript: ENSLAFT00000002851
Sequence length 114
Comment pep:novel supercontig:loxAfr3:scaffold_31:23486345:23488376:1 gene:ENSLAFG00000002852 transcript:ENSLAFT00000002851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSPQSKHHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKL
VKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
Download sequence
Identical sequences G3SR97
ENSLAFP00000002385 ENSLAFP00000002385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]