SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002459 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002459
Domain Number 1 Region: 930-1038
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 232-346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1276-1395
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-32
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 4 Region: 1453-1562
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-32
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 5 Region: 68-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 6 Region: 756-864
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-26
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 7 Region: 1805-1909
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 8 Region: 583-692
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 9 Region: 404-525
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.11e-26
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 10 Region: 1619-1733
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-24
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 11 Region: 1098-1213
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-23
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 12 Region: 2163-2231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 13 Region: 2519-2590
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-18
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 14 Region: 2579-2648
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.17e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 15 Region: 2403-2471
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.08e-17
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 16 Region: 2220-2287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.13e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 17 Region: 2702-2770
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2460-2530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 19 Region: 1911-1984
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 1567-1635
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000526
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 21 Region: 2094-2156
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 22 Region: 1974-2041
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000216
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 23 Region: 1394-1456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 24 Region: 2280-2347
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 25 Region: 2637-2698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000625
Family Complement control module/SCR domain 0.00069
Further Details:      
 
Domain Number 26 Region: 2336-2396
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 27 Region: 1043-1110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000189
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 28 Region: 352-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 29 Region: 695-758
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000229
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 870-933
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 6-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 32 Region: 1220-1283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000236
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 33 Region: 177-245
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 34 Region: 1737-1801
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000513
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 35 Region: 2046-2111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000681
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 36 Region: 525-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000863
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 37 Region: 2761-2819
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000104
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002459   Gene: ENSLAFG00000002950   Transcript: ENSLAFT00000002951
Sequence length 3053
Comment pep:novel supercontig:loxAfr3:scaffold_34:12093767:12369789:-1 gene:ENSLAFG00000002950 transcript:ENSLAFT00000002951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEQGSCGDPGIPAYGRREGSRFRHGDTLKFECQPAFELVGQKAITCQKNNQWSAKKPGC
VFSCFFNFTSPSGIVLSPNYPEDYGNHLHCVWLILARPESRIHLAFNDIDVEPQFDFLVI
KDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTDHSTGKRGFNITFTTFRHNECPDP
GVPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETITCILKEGSVVWNSAVLRCEAPCGG
HLTSPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIKITFDRFKTEVNYDTLEVRDGRTY
SAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQLRYETITLQSDHCLDPGIPV
NGQRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPNFQWSRALPSCEALCGGFIQGSSGT
ILSPGFPDFYPNNLNCTWIIETSHGKGVFFTFHTFHLESGHDYLLITENGSFTQPLKQLT
GSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITFSEYDLEPCEEPEVPAYSIRKGLQ
FGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPLPRCVAECGNSVTGTQGTLLSPNF
PVNYNNNHECIYSIQTQPGKGIQLKAKAFELSEGDVLKVYDGNNNSARLLGVFSRSEMMG
MTLNSTSSSLWLDFITDAENTSKGFELQFSSFELIKCEDPGTPLFGYKVHDGGHFAGSSV
SFSCDPGYTLRGSEELLCLSGERRTWDRPLPICVAECGGTVKGEVSGQVLSPGYPAPYEH
NLNCIWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDGPVESGVLLKELSGPALPKDLHST
FSSVVLQFSTDFFTSKQGFAIQFSVSTATSCNDPGVPQNGSRSGSSWEAGDSTVFQCDPG
YALQGSAEISCVKIENRFFWQPSPPTCIAPCGGDLTGPSGVILSPNYPEPYPPGKECDWK
VTVSPDYVIALVFNIFNLEPGYDFLHVYDGRDSLSPLIGSFYGSQLPGRIESSSNSLFLA
FRSDASVSNAGFVIDYTENPRESCFDPGSIKNGTRVGSDLKLGSSITYYCHGGYEVEGSS
TLSCILGPDGKPVWNNPRPVCTAPCGGQYVGADGVVLSPNYPQNYTSGQICLYFVTVPKD
YVVFGQFTFFHTALNDVVEVHDGHSQQSRLLSSLSGSHTGESLPLATSNQVLIKFSAKGQ
APARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDFSVGAVVRFECNSGYALQGSPEIE
CLPVPGALAQWNVSAPTCVVPCGGNLTERRGTILSPGFPEPYLNSLNCVWKIVVPEGAGI
QIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNQLYLHFYSDISVSA
AGFHLEYKTVGLSSCPEPAVPSNGVKSGERYLVNDVVSFQCEPGYALQGHAHISCMPGTV
RRWNYPPPLCIAQCGGAVEEMEGVILSPGFPGNYPSNMDCSWKIALPVGFGAHIQFLNFS
TEPNHDFIEIRNGPYETSRMMGRFSGSELPSSLLSTSHETTVYFHSDHSQNRPGFKLEYQ
AYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPGYQLIGHPVLTCQHGTNRNWDHPLP
RCEVPCGGNITSSNGTVYSPGFPSPYSSSQDCVWLITVFTGHGIRLNLSLLQAETSGDFI
TVWDGPQQTAPQLGVFTRSLVKKTLHSSSNQVLLKFHRNAATGGIFAIAFSAYPLTKCPP
PTILPNAEVVTENEEFNIGDIVRYRCLSGFTLVGNEILTCKLGTYLQFEGPPPICEVHCP
TNELLTDSTGVILSQSYPGSYPQFQTCSWLVRVEPEYNISLTVEYFLSEKQYDEFEIFDG
PSGQSPLLKALSGNYSAPLIVTSSSNSVYLRWSSDHAYNRKGFKIRYSAPYCSLPRTLLH
GFILGQTSTQPGGSIHFSCNTGYRLVGHSMAICTRHPQGYYLWSEAIPLCQALSCGIPEA
PKNGMVFGKEYTVGTKAVYSCSEGFHLQAGAEATVECLETGLWSNHNIPPQCVAVTCPDI
SSISVEHGRWRLIFETQYQFQAQLMLICDPGYYYTGQRVIRCQANGKWSLGDSLPTCQII
SCGELPIPPNGHRIGTLSDYGATAIFSCNSGYTLVGSRVRECMANGLWSGSEVRCLAPAK
AGHCGTPEPIVNGHINGENYNYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVPI
TCGHPGNPVNGLTQGNQFNLNDVVKFVCNPGYVADGAARSQCLASGQWSDMLPTCRIINC
TDPGHQENSTRQVHASGLHRFSYGTTVLYQCNHGFYLLGTPVLSCQGDGTWDRPRPQCLL
VSCGHPGSPPHTQMSGDSYTVGAVVRYSCTGKRTLVGNATRMCGLDGHWTGSLPHCSGTS
MGFCGDPGIPAHGIRLGDSFASGSLMRFSCEAGHALRGSSERTCLANGTWSGTQPECGVI
SCGNPGTPSNARVVFSDSLVFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECIVIN
CGDPGIPANGLRLGNDFRYNKTVTYQCVPGYMMESHRVSVLSCTKDRTWNGTKPVCKAIM
CKPPQLIPNGKVVGSDFMWGSSVIYTCLEGYQLSLPAVLTCEGNGSWTGELPQCFPVFCG
DPGVPPRGRREDRGFSYRSSVSYSCQPPLVLVGSPRRFCQSDGTWSGTQPSCIANPDPTL
TMCADPGVPQFGIQNNSQGYQVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGTPPDCIPH
HCKQPETPTHANVGALDLPSMGYTLIYSCQEGFSLKGGSEHRTCKADGSWTGKPPICLVN
LMLEWHYTVCNSPIPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQAVSSKVNATMIDHS
GVELHLAGIYKKEDFHLLLQVYQITGPVEIFVNKFKDDHWALDGHVSSESSGGTFIYQGS
VKGQDFGQFGFQRLDLRLLESDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKH
RRRPKVPFNGYAGHENTNVRATFENPMYDRNIQPTDIMAAEAEFTVSTVCTAV
Download sequence
Identical sequences G3UK80
ENSLAFP00000002459 ENSLAFP00000028239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]