SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002464 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002464
Domain Number 1 Region: 270-328
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000862
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 123-185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 86-138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000653
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002464   Gene: ENSLAFG00000002956   Transcript: ENSLAFT00000002956
Sequence length 473
Comment pep:novel supercontig:loxAfr3:scaffold_56:15590279:15635876:1 gene:ENSLAFG00000002956 transcript:ENSLAFT00000002956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGSGNLGPARFTLRGPLSLKEWPQKLLLCVLIAPLAWTMPIGSGDSPPEDDEAEYSHARY
KDTPWCSPIKVKYGNVHCRAPQGGYYKTALGTRCDVRCQKGYELHGSSQLICQSNKRWSD
KVICKQKRCPTLVMPANGGFKCVDGAYFNSQCEYYCSPGYTLKGERTVTCMDNKAWSGRP
ASCVDIEPPRIKCPSVKERIAEPNKLTIRVSWDTPEGRDTADGILTDVILKGLPPGSNFP
EGDHKIQYTVYDRAENKGTCKFRVKVRVKRCSKLNAPENGYMKCSSDGNNYGATCEFSCI
GGYELQGSPARVCQSNLAWSGTEPTCAAMNVNVGVRTAAILLDQFYEKRRLLIVSAPTAR
NLLYRLQLGMLQQAQCGMDLRHITMVELVGVFPTLIGRIGTKIMPPALALQLRLLLRIPL
YSFSMVLVDKHGTDKERYNSLVTPMALFNLIDTFPLRKEEMVLQAEMGQTCSN
Download sequence
Identical sequences G3SRF7
ENSLAFP00000002464 ENSLAFP00000002464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]