SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002552 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002552
Domain Number 1 Region: 6-221
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.19e-46
Family Eukaryotic proteases 0.00063
Further Details:      
 
Domain Number 2 Region: 390-502
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-26
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 3 Region: 292-379
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000115
Family Spermadhesin, CUB domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002552   Gene: ENSLAFG00000003057   Transcript: ENSLAFT00000003059
Sequence length 524
Comment pep:novel supercontig:loxAfr3:scaffold_2:19429263:19458617:-1 gene:ENSLAFG00000003057 transcript:ENSLAFT00000003059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSNVSGGEDVYGEMYIRQVSLKLSKHHFCGGSLIQDDLVITAAHCLVSLNDFVMQIKNL
TVTTEEYGLFQKNKQEQNIPASNIVSHLEYNRFGYMNSDITLLYLKHRVKFGISVQSICL
PGSDDKFEVEFMCPGSWSSTSEYSSVLQEVELPILDDRIFNPGLKDMNPPPLGGTMVCAV
FPDGGKDARQGDFGGPLVCRRDDGTGTVAGITSWGTGFARGEDPLRNNQRRASTGLFSKI
RKMWVCRGFGVGPTPPDMNPRCVTKDLISVQNVDGSHREEGMYSFPHKRHVFYYHLYLCI
WKIMVSEDKIILIKFTSLDRKSSFHRPVLGMLQAAYLPRGKVCGDMLPPPLLTDTNEIAV
TLVSDTESGGSAFELTFTAKNSEAGISDSGCGRVAVLVEEGIIHSASYPDLYPRNVTCHW
FIHAPEKHIIKLAFEEFTIGFNQNSTHDAVVIYGDPEEEHELAKLCGVLNPTPICSPSNM
TVIRFKSDGENDFQGFRQRFTFLPSGALKIGLRTLYQDVTVILR
Download sequence
Identical sequences G3SRM6
ENSLAFP00000002552 ENSLAFP00000002552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]