SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002630 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002630
Domain Number 1 Region: 554-778
Classification Level Classification E-value
Superfamily GFP-like 2.2e-85
Family Domain G2 of nidogen-1 0.000000587
Further Details:      
 
Domain Number 2 Region: 1140-1396
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-44
Family YWTD domain 0.0000001
Further Details:      
 
Domain Number 3 Region: 928-1039
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 9.42e-22
Family Thyroglobulin type-1 domain 0.00058
Further Details:      
 
Domain Number 4 Region: 1047-1117
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.28e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 5 Region: 510-551,789-886
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 6 Region: 878-937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000287
Family EGF-like domain of nidogen-1 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002630   Gene: ENSLAFG00000003163   Transcript: ENSLAFT00000003167
Sequence length 1408
Comment pep:novel supercontig:loxAfr3:scaffold_9:27463910:27540706:-1 gene:ENSLAFG00000003163 transcript:ENSLAFT00000003167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAQPLVGWLAGPGTRSATGQHTGRSRVAALPPRRGLPLTGRRGGDRSLAGRRMPRPSSG
EAGNPPLHFYESQVQGPSYVGTNGIISTQDFPRETQYVDDDFPTDFPAIAPFLADIDTSQ
GRGRILYREDTSPAVLGLAARYVRAGFPRSITRFAPTHAFLATWEQVGAYEEVTRGAPPS
GELNTFQAVLVSDESDTYALFLYPANGLQFFGTRPKESYNVQLELPARVGFCRGEADDLK
REGPYFSLTSTEQSVKNLYQLSNLGISGVWAFHIGSTSPLDNVRPATLGGDLSKAHSLAS
LEHSFSHTAALESDYTEDNLDYYDENEEEAEYPPSEPEEAGNGHGSVDVSFPVKVDSRPS
GGDVSPPNSDLAALLPHPTPSDWPFYPETESATWDPQTKEGKIGTPGLNGRVEASEQIET
RSSAPPETDRDSLDPPQKALPYAENEHLQPYPDGGVVPSETDVPAARPGEVVPPHYPLPD
HTAPRSSRRFVVGVEDNISSNTEVFTYNAANKETCEQNHRQCSQHAFCTDYTTGFCCHCQ
TRFYGNGKYCLPEGAPQRVNGKVSGHLRVGHTPVHFTDVDLHAYIVGNDGRAYTAISHIP
QPAAQALLPLTPIGGLFGWLFALEKPGSENGFSITGATFTHDMEVTFYPGEEKVHITQTA
EGLDPENYLSVKTNIQGQVPYIPANFTAHIAPYKELYHYSDSVVTSTSSRDYSLTFGAIN
QTLSYRIHQNITYQTCRHAPRHQAIPTTQQLNVDRAFALYNDEERVLRFAVTNQVGHVEV
DSDPAPVNPCYDGSHTCDTTAQCHPGTGLAYTCECAPGYQGDGRNCVDVNECATGVHHCG
PNSVCINLKGSYKCECRSGYEFADDRHTCIVIAPPPNPCEDGSHTCAPAGQARCIHHGGS
TFTCACLPGYVGTGHQCTDVDECLENRCHPAATCYNTPGSFSCRCQPGYHGDGFQCTPAL
DPEDSVSGLKPCEHQQRYVQVQPAYPGSPLHIPQCDEQGNFLPLQCHSSTGFCWCVDQRG
HEIPGTRTPPGSTPPHCGAPGSEPTQRPQTVCERWRESLLEHYGGTARDDQYVPQCDDLG
QFIPLQCHGKSDFCWCVDKDGREVEGTRSQPGTTPACIPTVAPPMVRPTPRPDVTPPSVG
TFLVYAQGQQIGHLPLNGTRLQKDAAKTLLSLHGSIVVGIDYDCRERMVYWTDVAGRTIS
RASLEPGAEPETVINTGLISPEGLAIDHFRRTMYWTDSGLDKIESSKLDGSERRVLFHTE
LVNPRAITVDPIRGNLYWTDWNREAPKIETSSLNGENRRILVNKDIGLPNGLTFDPFSKL
LCWADAGTKKLECTLPDGTGRRVIQHNLNYPFSIVSYADHFYHTDWRRDGVISVNKDSGQ
FTDEYLPEQRSHLYGITAVYPYCPTGNE
Download sequence
Identical sequences G3SRU1
ENSLAFP00000002630 ENSLAFP00000002630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]