SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002641 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002641
Domain Number 1 Region: 208-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 2 Region: 250-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000205
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 171-216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000522
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 134-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000541
Family EGF-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000002641
Domain Number - Region: 102-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002641   Gene: ENSLAFG00000003181   Transcript: ENSLAFT00000003181
Sequence length 420
Comment pep:novel supercontig:loxAfr3:scaffold_0:121123228:121127317:1 gene:ENSLAFG00000003181 transcript:ENSLAFT00000003181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISVPLSPRPAASQPVPSHRCPHVRPSIRQSLLGPALTMPSGCRCLHLVCLLCILGPPGQP
ARADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGW
AGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCPPGFHGHDCERKAGPCEQAGSPCQ
NGGQCQDNQGFALNFTCRCLAGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEG
FAGRFCTINLDDCASHPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPFTTADLP
LGPTSAVVVPTTGPVPHSAGAGLLRISVKEVVRRQEAALAESSLVAVVVFGALTAALVLA
TGLLTLRAWRRGVRPPGPCCYPIPHYAPARQDQECQVSMLPAGLPLPPDLPGEPGKTTAL
Download sequence
Identical sequences G3SRV1
ENSLAFP00000002641 ENSLAFP00000002641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]