SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002810 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002810
Domain Number 1 Region: 8-55
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000123
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 60-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002810   Gene: ENSLAFG00000003378   Transcript: ENSLAFT00000003378
Sequence length 192
Comment pep:novel supercontig:loxAfr3:scaffold_7:45588760:45602275:1 gene:ENSLAFG00000003378 transcript:ENSLAFT00000003378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDSASSPINCQWDSYAPWSECDGCTKTQTRRRSIAVYGQYGGLPCVGSAFETQSCEPTRG
CPVEEGCGERFRCSSGQCISRSLVCNGDSDCEEDSSDEDRCEGSENRPSCDIDKPPPNVE
LTGNGYNALTGKFRNRVINTKSFGGQCRKVFSGDGRDFYRLSGNVLSYTFQVPNYIDCLK
TNLSFHDRFASF
Download sequence
Identical sequences G3SS95
ENSLAFP00000002810 ENSLAFP00000002810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]