SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002816 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002816
Domain Number 1 Region: 496-559
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000148
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 416-464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 3 Region: 550-606
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000526
Family Complement control module/SCR domain 0.0035
Further Details:      
 
Domain Number 4 Region: 1-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000002816
Domain Number - Region: 368-406
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002816   Gene: ENSLAFG00000003388   Transcript: ENSLAFT00000003386
Sequence length 786
Comment pep:novel supercontig:loxAfr3:scaffold_7:45834706:45896093:-1 gene:ENSLAFG00000003388 transcript:ENSLAFT00000003386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRCIASKLECNGENDCGDNSDERDCGRTKAVCPRNYYPIPSVQLMGTGFHFLAGEPRGEV
LDNSFTGGMCKTVKSSKASNPYRVPANLETVNFEVSTEEDDLETEFYKDLISQERDKNQQ
EAFSNQHEGSFSVPIFYSSKKSQSVNHMSAFKQAIQASHKKDSRFIRIHKAIKVLNFTMK
SKDLQLSDVFLKALSHLPLEYNFALYSRIFDDFGTHYFTSGSLGGVYDLLYQFSSEELKN
SGLTEEESQNCVRIETKKRFGFFKKKTVEHRCTKNKLSEKYEGSFLQGAEKSISLVRGGR
SEYTAALAWEKGSSGPEEKVFSEWLESVKENPAVINFELAPIMDLLRNIPCAVTKRNNLR
KAFQEYAAKFDPCKCAPCPNNGQPTLSGTECLCVCQSGTYGENCEKRSPDFQSKAVNGNW
GCWSFWSRCDATYKRSRTRQCNHPAPQQGGKPCDGEQRQEEDCTFSIMENNGQPCISDDE
EMKEVDLPEIEADSGCPRPVPPENGFIRNEKKLYSVGEEVEIFCFTGFKAVGYQYFRCLP
DQTWRQGDVQCQRIGCLKPVLPEVLTLSPFERVYKIGNSIELSCPKGLVVAGPSKYTCSG
DSWTPPISDSLTCEKDILTKLQGHCQLGQKQSGSECICMSPAEDCSSYSEELCVLDTASS
HHFTSSACELSAEKCLNNQQLHFLHVGSCQDGPQLEWGLERVKLSLDSTKRESCGYDTCY
DWEKCLASTSKCICLLPPQCFKGGNQLYCVTTGLSTREKTLNICEVGAIKCAGRKLEILH
PGRCLT
Download sequence
Identical sequences G3SSA0
ENSLAFP00000002816 ENSLAFP00000002816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]