SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002957 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002957
Domain Number 1 Region: 91-237
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-34
Family C-type lectin domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002957   Gene: ENSLAFG00000003550   Transcript: ENSLAFT00000003548
Sequence length 241
Comment pep:novel supercontig:loxAfr3:scaffold_15:55293376:55303623:1 gene:ENSLAFG00000003550 transcript:ENSLAFT00000003548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGDEIYTSLQWDDPSPNYYEKPLSPNKCSGTWCLVTVISCIFCMGSLTASIFLGIKLFQ
VSTIAMEQQEKLTQQDRALLNFTQWKGKHDLLMKCCQALMQKSFSSARNCSPCPDNWIWN
GESCYYIFEKWQGWRQSKEDCSKEDSKLLQIDTKEEMDFITRILWKTKKDFHFWVGLSQE
GLSGPWLWQDGSSLSPDLGSIQRFQSINEDCGYLRDKSLFSANCSSWKYFICEKYPVSST
L
Download sequence
Identical sequences G3SSL6
ENSLAFP00000002957 ENSLAFP00000002957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]