SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002960 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002960
Domain Number 1 Region: 95-261
Classification Level Classification E-value
Superfamily C-type lectin-like 1.47e-31
Family C-type lectin domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002960   Gene: ENSLAFG00000003552   Transcript: ENSLAFT00000003551
Sequence length 270
Comment pep:novel supercontig:loxAfr3:scaffold_15:55310366:55333692:-1 gene:ENSLAFG00000003552 transcript:ENSLAFT00000003551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAKYSSTKDMLDDDGDTTISLHSRASTTTRRPGPEHTEHQAPSSVWRPLTLTVLTLCLV
LLIGLAALGILFFQFYQLSITQQDSISQKEERLGNLSQQLQSLEAQNRKLAATLQRMAEN
LCRELYNKTGEHRCSPCPGKWKWRGDKCYQFYKESRSWQGCEYFCIAENSTMLKINTQEV
LEFAMPQSYSEFFYSYWTGLSRNSSGKDWLWMDGTHYSSELFDIVIDFTSIRSRDCVTIL
NGKAFSKDCRELRRCACERTAAAVRPEWLY
Download sequence
Identical sequences G3SSL8
ENSLAFP00000002960 XP_003410730.1.64505 ENSLAFP00000002960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]