SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002963 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002963
Domain Number 1 Region: 107-245
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-34
Family C-type lectin domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002963   Gene: ENSLAFG00000003555   Transcript: ENSLAFT00000003554
Sequence length 246
Comment pep:novel supercontig:loxAfr3:scaffold_15:55343248:55359181:-1 gene:ENSLAFG00000003555 transcript:ENSLAFT00000003554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYYSNTENLDEDGYTQLDFNSRDNSRRPIVSKKGTCAASPRWCVIAVILGILFLITLVI
AVVLGTKDEAVWRSYSGSNPLENNFSSRSNQNQSQPTQSSLEESMSPTKALTTRGVFSSP
CPPNWIIHEKSCYLFRKSQDSWDKSKKQCSQQGSSLLKIDSSEELEFIRKQVSSQPDNSF
WIGLSRPQTEGPWLWEDGSTFSSNLFQIRSTVNLESLSHNCVWIHLSIIYNQLCNVHSYS
ICEKTI
Download sequence
Identical sequences G3SSM1
ENSLAFP00000002963 ENSLAFP00000002963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]