SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003117 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003117
Domain Number 1 Region: 149-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000621
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 2 Region: 89-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000328
Family Complement control module/SCR domain 0.00015
Further Details:      
 
Domain Number 3 Region: 29-94
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000328
Family Complement control module/SCR domain 0.0000865
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003117   Gene: ENSLAFG00000003738   Transcript: ENSLAFT00000003737
Sequence length 553
Comment pep:novel supercontig:loxAfr3:scaffold_13:12727499:12752035:1 gene:ENSLAFG00000003738 transcript:ENSLAFT00000003737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPPPSSRPAPGCSNPLSTLLLFSSLGDCGLPPDIPNAQPPLGGLTRFPEDATITYKCNE
GFVKVPGKPDSVVCIKDKWSEVAEFCNRSCDVPTRLVFASLKQPYSKQSYFPAGSTVEYE
CRLGYEKDQSLSGKLTCLQDFTWSKPAEFCKKKACPDPGKIKNGHVNIPSGILFGSAIFF
SCNTGYELVGVTSSYCLLMGKDVGWRDPLPECKVIICTILIHLATMQQQSNSYTISQAQA
TTCLIGGLLVASNCFYYFKKEVLGKYKTRLRFPKATELPLTAQKPTSENLPATEPLLTAQ
KPTSENLPATELPLTAQKPTSENILATELPLTAQKPTSENLPATELPLTAQKPTSENLPA
TEPPLTAQKPTSENILATELPLTPQKKPTSANASATEVPATAQKPPVSNALPRETSPAAQ
NPNTAKDSAAQATPTAQRASTTKASFTQSLPTTQKSTAIHAPVAKGLQTTQTSVRITAIR
GLAVPRATTRFHATSTSKGRGTPPSSGAMILTSGKSGSQTVKRKCHCGMYNPYSWKRILS
FNCLSCCCFLYFE
Download sequence
Identical sequences G3UHL3
ENSLAFP00000003117 ENSLAFP00000027321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]