SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003280 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003280
Domain Number 1 Region: 868-1148
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-71
Family Protein kinases, catalytic subunit 0.00000836
Further Details:      
 
Domain Number 2 Region: 463-554,583-609
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000685
Family SH2 domain 0.01
Further Details:      
 
Domain Number 3 Region: 373-439
Classification Level Classification E-value
Superfamily PH domain-like 0.00000016
Family Third domain of FERM 0.018
Further Details:      
 
Domain Number 4 Region: 147-271
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000022
Family Second domain of FERM 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003280
Domain Number - Region: 576-681
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000151
Family Protein kinases, catalytic subunit 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003280   Gene: ENSLAFG00000003922   Transcript: ENSLAFT00000003924
Sequence length 1169
Comment pep:novel supercontig:loxAfr3:scaffold_26:33310065:33331271:1 gene:ENSLAFG00000003922 transcript:ENSLAFT00000003924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVQSMPLCRWGATARGSKPDGNGAQPMVSRGVLRVHLHWAGPGGGEPWVTFSEASLTAEE
VCIYIAHKIGITPLCFNLFALFDAQGQVWLPPNHILEVPRDSSLNLHFRMRFYFRNWHGM
NPQEPAVYRCGPPGAESSSDQAEHGLQFLDPASFEYIFEQGKHEFVNDVASLWELSSEEE
IHHFKNESLGMAFLHLCHLALHRGVSLEEVAKKISFKDCIPRSFRSQIQQHNALTRLRLR
SIFHKFLRAFQPSHLSQQLVMVKYLATLERLAPCFATEHIPVCHLELPAQAEGKLCYIQD
HGQATLDPGKESALGPPTHEVLVTGTGGIQWRPVQAEGSGGSGSGSRNPQANLSGKKAQA
QEVDLQPASRPKGLPWASFCDFQDISHLVVKEHHVSVYCQDNKCLELTLPSRATALSFVS
LVDGYFRLTVDSSHYLCHEVAPPRLVMSIQDGIHGPLLDPFVLAKLQPEDGHYLIHWSSS
HLYRLILTVAQRDQAQGSRSLRLRKFTIEQQAGTFTLEGWDRSFPSVGALRAALQDCSLR
VGDDCFSLRRCCLPLSRELSNLIIMRGPAASTRPLNLSQLSFHRVCREEITQLSHLGQGT
RTNVYEGLLRVKGRDSEEDKEEGGDPLSPSRGSGQELRVVLKVLDPSHHDITLAFYEIAS
LMSQVSHVHLAFVHGICVHGSESECPLPLLIGQLPLIPSPWPVVAIPEPLTCTPYPGYTP
TLNLRPFPWLHLNSQIRPQLLTTPPQASLYPDPTPWLHHECLHLPPKTLYNPAPIFPLTS
LALTLCDTALTSALQFNPAQSPLYLYPYCVSLKIPVLSTPSPASITSYECLTYEPAQRPS
FRIILRDLTRLQPHNLVDVSAVSPDLPASDPTVFHKRYLKKIRELGEGHFGKVSLYCYDP
TNDGTGEMVAVKSLKAGCGPQLRSGWKREIDILRRLYHEHIVKYKGCCEDPGEKSVQLVM
EYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYIHRDLAARNVLLDNDRLVK
IGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVWSFGVTLYELLTRC
DFSQSPPLKFIELLGLTQGQMTVLRLTELLERGERLPRPEACPCEIYYLMKNCWEAEASF
RPTFQNLIPILKTVHEKYQGQAPSVFSMC
Download sequence
Identical sequences G3STB4
ENSLAFP00000003280 ENSLAFP00000003280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]