SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003392 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003392
Domain Number 1 Region: 105-217
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-29
Family C-type lectin domain 0.00000998
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003392   Gene: ENSLAFG00000004061   Transcript: ENSLAFT00000004062
Sequence length 218
Comment pep:novel supercontig:loxAfr3:scaffold_115:1168180:1171051:-1 gene:ENSLAFG00000004061 transcript:ENSLAFT00000004062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHPLILSLLLLGTVSALHLCNDFPKLESLETVADLSQDLEGSGEQEGKLAPTEKVVQSE
EEEVESFGYEDALEDEEDTEKDLQCPREEDTVHLLGSPGCKTCRYLLVRNLRTFRKAQNI
CSRCYRGNLASIHSFSSNYRIQLVTSRINQAQVWIGGILKGWFRCRRFRWTDGSRWDFGF
WASGQPGNGRGRCVALCTRGGRWRRNRCKRRLPFICSF
Download sequence
Identical sequences G3STK2
ENSLAFP00000003392 XP_003421379.1.64505 ENSLAFP00000003392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]