SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003439 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003439
Domain Number 1 Region: 194-379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-56
Family SPRY domain 0.000021
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000183
Family B-box zinc-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003439
Domain Number - Region: 24-169
Classification Level Classification E-value
Superfamily ARM repeat 0.0249
Family Armadillo repeat 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003439   Gene: ENSLAFG00000004126   Transcript: ENSLAFT00000004125
Sequence length 383
Comment pep:novel supercontig:loxAfr3:scaffold_22:40368991:40383333:1 gene:ENSLAFG00000004126 transcript:ENSLAFT00000004125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEKHLEPPKLFCEDDQVTFCVKCTPSQEHKHHVLYAVGEAVENYQKLFQEMLNTLRKKLE
IAQNILADEQERMVIIQGLRDLRKEASLNQLIKLATELEEKPQEILQRLGDLMRDRMDKL
KESEAWLSEQICSLQGVIAELEKKCGEPSVALLHEIISSKFEFEKCKLLAVLRLHIHIKR
SFSMFSKDWLDLANFLAQNQRHITLDPETAHPFLVLYEDLRSVRFGNVQQAVPGHPGRFD
FSATVLGVERFTSGRHYWEVDVGKAANWQLGVCRDSVSGQGGRPNAHGEKVLLTRSMMGV
DCTFWVFPPLKRISLRQQMHRVGVFVDCEYGQVSFYNVTERSFIYSLSYLPFHGTVRPIF
SICIPNEGTSSDSLTICPPQHWQ
Download sequence
Identical sequences G3STN8
ENSLAFP00000003439 ENSLAFP00000003439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]