SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003442 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003442
Domain Number 1 Region: 44-798
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.9e-267
Family Motor proteins 0.000000000237
Further Details:      
 
Domain Number 2 Region: 1212-1308
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-28
Family Pleckstrin-homology domain (PH domain) 0.0082
Further Details:      
 
Domain Number 3 Region: 1391-1511
Classification Level Classification E-value
Superfamily PH domain-like 8.84e-22
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 4 Region: 1794-1863,1906-1950
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-16
Family Second domain of FERM 0.007
Further Details:      
 
Domain Number 5 Region: 1329-1383
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000223
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily PH domain-like 0.000000178
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003442
Domain Number - Region: 792-930,1214-1239
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00575
Family FCH domain 0.036
Further Details:      
 
Domain Number - Region: 1701-1787
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00586
Family Ras-binding domain, RBD 0.021
Further Details:      
 
Domain Number - Region: 1954-2040
Classification Level Classification E-value
Superfamily PH domain-like 0.0492
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003442   Gene: ENSLAFG00000004123   Transcript: ENSLAFT00000004128
Sequence length 2058
Comment pep:novel supercontig:loxAfr3:scaffold_7:18963102:19209217:-1 gene:ENSLAFG00000004123 transcript:ENSLAFT00000004128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSFFPSGTRVWLRENGQHFPSTVNSCAEGVVVFRTDYGQVFTYKQSTITHQKVTTMHPTN
EEGVDDMATLTELHGGSIMYNLFQRYQRNQIYTYIGSIIASVNPYKTIPGLYERTTMEQY
SKHHLGDMPPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQS
LELSLKEKTSCVEQAILESSPIMEAFGNAKTVYNSNSSRFGKFIQLNICQKGNIQGGRIV
DYLLEKNRVVRQNSGERNYHIFYALLAGLGDGEREEFYLSIPENYHYLNQSGCIEDKTIN
DQESFKEVIKAMGVMQFTKEEVREVLRLLAGILHLGNIEFITAGGAQVSFKTALGRSAEL
LGLDSTQLTDALTQRSMILRGEEILTPLNVQQAVDSRDSLAMALYARCFEWVIKKTNSRI
KGKDDFKSIGILDIFGFENFEVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVW
EDIDWIDNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHNQHANNHFYVKPRVAV
NNFGVKHYAGEVHYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLK
CGSKHRRPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYSG
MLETVRIRKAGYAVRRPFQDFYKRQEGAAWLMRNLTLPEDVRGKCTALLQLYDASNSEWQ
LGKTKVFLRESLEQKLEKRREEEVTRAAMVIRAHILGYVARKQYRKVLSCVVTLQKNFRT
LLLRRRFLHLKKAAIIFQKQLRGQLARRVYKQLLAQKQEEEKKKREEEERRKREEEERER
ERVRREAEIRAQQEEEARKRQELEALQKRQEEAALTRELEKQKENKQVEEILRLEKEIED
LQRMKEQQELSLTEASLQKLQQLRDEELRRLEDEACRAAQEFLESLNFDEIDECVRNIER
SLSAGSEFHDLAESASAEKPSFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHSDQRT
SGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSAPDSVSLQNSSSGESTYCLPQNPG
DLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSCSSQWSPDYRCSVGTYNSSGAYRFSSEG
AQSSFEDSEEDFDSRFDTDDELCYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRWCVLK
DETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKRRWFVLRQSKLMYFENDSEEKLKGT
VEVRTAKEIIDNTSKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEIREMH
DEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWITLLQ
RSKGDTRVEGQEFIVRGWLHKEVNNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNAVKLG
TLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVTDTKA
PIDTPTQQLIQDIKENCLNADVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNLLKDK
GYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNRVPHP
GSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFIYESLKKTK
CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRN
MFALFEYNGHLDKAIESRTIVADVLAKFEKLAATSEAGDLPWKFYFKLYCFLDTDNVPKD
SVEFAFMFEQAHEAVIHGHYPAPEENLQVLAPLRLQYLQGDYTPHIAVPALEEVYCLPRL
KARISQSTKSFTPGERLEKRRTSFLEGTLRRGFRTGTVLRQKVEEEQMLDMWVKEEVSSA
RANIIDKWKKFQGLSQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVSADAV
SVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAYISMI
VKKRYSTSRSVSSQGSSR
Download sequence
Identical sequences G3STP1
ENSLAFP00000003442 ENSLAFP00000003442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]