SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003457 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003457
Domain Number 1 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Domain Number 2 Region: 364-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 3 Region: 451-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.017
Further Details:      
 
Domain Number 4 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000474
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 5 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Integrin beta EGF-like domains 0.028
Further Details:      
 
Domain Number 6 Region: 412-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000558
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Domain Number 7 Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003457
Domain Number - Region: 325-363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Domain Number - Region: 140-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00474
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number - Region: 59-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003457   Gene: ENSLAFG00000004148   Transcript: ENSLAFT00000004147
Sequence length 494
Comment pep:novel supercontig:loxAfr3:scaffold_29:20036311:20298449:1 gene:ENSLAFG00000004148 transcript:ENSLAFT00000004147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWSGAACRLSRAESERRCRAPGQPPGS
ALCHGRGRCDCGVCICHVTEPGMYFGPLCECHEWVCETYDGKTCAGHGKCDCGRCKCDEG
WSGEACQYPNKCDLTKKRSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGHGLVYGKFCEC
DDRECIDDETEEICGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGRICS
NRGICVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
CKVGWYGKKCEHPRSCPLSAEESIKKCQGSSTLPCSGRGKCECGRCTCYPPGDRRVYGKT
CECDDRRCEGLDGVVCGGRGRCSCGHCVCEKGWFGTLCQHPQKCNITEEQSKSLCESADG
ILCSGKGACHCGKCICSTQEWYVSGEFCDCDDRDCDKYDGLLCTGNGICSCGNCECWDGW
NGNACEIWLGTDYP
Download sequence
Identical sequences G3STQ4
XP_003414014.1.64505 ENSLAFP00000003457 ENSLAFP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]