SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003561 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003561
Domain Number 1 Region: 3953-4324
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.31e-101
Family Regulator of chromosome condensation RCC1 0.0013
Further Details:      
 
Domain Number 2 Region: 4460-4792
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.05e-88
Family Hect, E3 ligase catalytic domain 0.0000348
Further Details:      
 
Domain Number 3 Region: 423-779
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.09e-86
Family Regulator of chromosome condensation RCC1 0.0078
Further Details:      
 
Domain Number 4 Region: 2962-3254
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.76e-61
Family Regulator of chromosome condensation RCC1 0.0016
Further Details:      
 
Domain Number 5 Region: 2731-2913
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.59e-31
Family APC10-like 0.0059
Further Details:      
 
Domain Number 6 Region: 2556-2633
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.23e-29
Family CPH domain 0.00065
Further Details:      
 
Domain Number 7 Region: 3204-3327
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.45e-28
Family Regulator of chromosome condensation RCC1 0.046
Further Details:      
 
Domain Number 8 Region: 1865-1931
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.62e-21
Family Mib/herc2 domain 0.00013
Further Details:      
 
Domain Number 9 Region: 1208-1292
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 0.0000000000000864
Family Cytochrome b5 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003561
Domain Number - Region: 2455-2508
Classification Level Classification E-value
Superfamily UBA-like 0.000401
Family UBA domain 0.0095
Further Details:      
 
Domain Number - Region: 3621-3711
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0202
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003561   Gene: ENSLAFG00000004263   Transcript: ENSLAFT00000004270
Sequence length 4838
Comment pep:novel supercontig:loxAfr3:scaffold_95:4371746:4682039:-1 gene:ENSLAFG00000004263 transcript:ENSLAFT00000004270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSDSFCLVAQARLDSKWLKTDIQLAFTRDGLCGLWNEMVKDGEIVYTGTELTPNGELLP
RKDDGVDSQNGAKKEDLNDREKKEEEEAPVPAHRAKSILESWVWGKQPDVSELKECLTVL
VKEQQALSVQSAATTLSALRLKQRLVVLERYLIALSRTVFQENVKVKWKSSSISLPPVDK
KSSRPTGKGVEGLARVGSRAALSFAFAFLRRAWRSGEDADLCSELLQESLDALRALPEAS
LFDESTVSSVWLEVVERATRFLRSVVTGDVHGTPGTKGPGSIPLQDQHLALAILLELAVQ
RGTLSQMLSAIMLLLQLWDSGARETDNERSAQGTSAPLLPLLQRFQSILGSKDLLHPEAD
THLLSGPLSPNESFLRYLTLPQDNELAIDLRQTAVVVTAHLDRLATPCMPPLCSSPTSHK
GSLQEVIGWGLIGWKYYANVIGPIQCEGLASLGVTQIACAEKRFLILSRSGRVYTQAYNS
DALAPQLVQGLASRNIIKIAAHSDGHHYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPK
VISAFSGKQAGKHVVHIACGSTYSAAITAEGELYTWGRGNYGRLGHGSSEDEVIPVLVAG
LKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLDV
VKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDVAAGST
HCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPSALPGLDTKHIVGIACGPAQSFAWSSC
SEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVAMLNLLRLQ
LHAAISHQVDPEFLGLGLGSVLLNSLKQTVVTLASSAGVLTTVQAAAQAVLQSGWSVLLP
TAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITAEIQDI
EAKKEAQKEKEIDEQEANASSFHRSRTPLDKDLINTGIYESSGKQCLPLVQLVQQLLRNI
ASQTVARLKDAARRISLCLDFEQQQSRERSASLDLLLRFQRLLISKLYPGESIGQSSDIS
SPELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIMEGDFTGVLLPELV
VSIMLLLSKNAGLMQEAGAIPLLGGLLEHLDRFNHLAPGKERDDHEDLAWPGIMESFFTG
QNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAGEDPV
VALEAALQFEDTQESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLGLHAS
YLAMSTPLSPVEVECAKWLQSSVFSGGLQTSQIHYSYNEEKDEDHCSSPGGTSASKSRLC
AHRWALGDHSQAFLQAIADNNMQDHTVKDFLCQIERYCKQYHLTTPITFPPEHPVEEVGR
LLLCCLLKHEDLGHVALSLVHVGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKTHQEQ
GRSYKEVCAPVIERLRFLFNELRPAVCNDLCIMSKFKLLSSLPRWRRIAQKIIRERRKKR
VPKKPGSTDDEEKIGNEESDLEEACILPHSPINVDKRPITIKSPKDKWQPLLSTVTGVHR
YKWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDTILKL
ATKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGKLYAW
AVQNIRNVLMDANAKFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMLNMLTLKHG
ANNLSLLLNSGTLALTQTALRLIGPSSDNVEEDMNAFARGASATVLEETRKETTPVQLPV
SGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTNSYRM
GKEGKYDLKLAELPASAQPSAEDLDTEDDSEAEQIERNIHPTSVMLTSTINLLQTLCLSA
GVHAEVMQSEATKTLCGLLRMLVESGTTDKTALPNNLVCREQHRSWCTLGFVRSIALTPQ
MCGALSSPPWITLLMQIVEGHAPFTAASLQRQILAVHLLKAVLPSWDKTERSKDMKCLVE
KLFGFLGSLLTTCSSDVPLLRESTLRRRRARPQASLTATHSSTLAEEVVVLLRTLHSLSQ
WNGLINKYINSQLHSITFGLAGKQSEGALLEDRFPNSESPEVGGLMAVLAVIGGIDGRLR
LGGQVMHDEFGEGTVTRITPKGRITVQFSEMRVRRVCPLSQLKALPAVMFSVTNLPFTEP
MLSVWAQLVNLAGNKLEKHKIKKSPKQAFAGQVDLDLLRCQQLKLYILKAGRALLSHQDK
LRQILSQPAVQEMGIAHTDDGAAASPDTGDMSPEGPQPPITLLQQLLASATQPSPVKAIF
DKQELEAAALAVCQCLAVESTHPSSPTCEDCSSSEATTPVTAQHARPSRVRKRKQSPVPA
LPIIVQLMEMGFPRRNIEFALKSFTGASGTASGLPGVEALVGWLLDHSDVQITDLSDADT
VSDEYSDEEMVEDVDDAGYPMSVGAVVTESQTYKKRADFLSNDDYAVYVRENIQVGMMVR
CCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPSSPSH
IKIGDKVRVKTSVTTPKYKWGSVTHQSVGVVKAFSANGKDVIVDFPQQSHWTGLLSEMEL
VPSIHPGVTCDGCQMFPINGSRFKCRNCDDFDFCETCFKTKKHNIRHTFGRINEPGQSAV
FCGRSGKQLKRCHSSQPGALLDSWSRMVKSLNVSSSVNQAARLIDGSEPCWQSSGSQGKH
WIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTIHINPTDTTVPLL
SDCTEYHRYIEIAIKQCRSSGIDCKIHGLIILGRIRAEEEDLAAVPFLASDNEEEEDDKG
SSGSLMRKKAAGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNVVQVA
GGSKSLFAVTVEGKVYACGEATNGRLGLGLSSGTVPIPRQITALSSYVVKKVAVHSGGRH
ATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAAITSSG
ELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLVFSWG
DGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDYFRLG
HGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDAGQVYAWGDNDHGQQGNGTTTVNR
KPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDSLGASYLGVPSDA
DSPAASNKISGANNSKPNRPSLAKILLSLDGNLAKQQALSHVLTALQLTYARDAVVGALM
PAGMMAPVECPSFSSPAPTSDVPAMASPMSGEECVLAVDIEDRLSPNPWQEKRGEIISSE
DAVTPSAVTPSASSASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKASGPEPQYLDE
FTSLLVADDTRVLVDLLKLSVCSRAGDRGKDVLSAVLSGMGTAYPQVADMLLELCVTELE
DVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHDPLT
VMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAAGPK
DLLSDRCILSCPSMDLVTCLLDFRLNLASPRGIVPRLAASLAACAQLSALAASHRMWALQ
RLRKLLTTEFGQSMNINRLLGDSDGETRALSFTGSALAALVKGLPEALQRQFEYEDPIVR
GGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDRRTPLPRL
FLEEVAKKIRELMADSENLDVLHESHDIFKREQDEQLVQWMNRRPDDWTLSAGGSGTIYG
WGHNHRGQLGGIEGAKVKVPTPCEALAALRPVQLIGGEQTLFAVTADGKLYATGYGAGGR
LGIGGTESVSTPTLLESVQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGHGNR
SPCDRPRVVESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLKPKL
VEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDSLTG
LGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIAIAT
GSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHTLAW
STSKPTSTGKLPAQVPMEYNHLQEIPMIALRNRLLLLHHISELFCPCIPMFDLDGCLHET
GLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGGLAG
PDGTKSVFGQMCAKMSAFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEELQNG
LTPLLIVTPNGRDESGANRDCYLLSPAARAPVHTSMFRFLGVLLGIAIRTGSPLSLSLAE
PVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDIQLS
SKHTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETMVCG
SPDIPLHLLKSVATYKGIEPSAPLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTIADF
RGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPKYSCKQVLEEKLKYAIHFCKSIDTDDY
ARIALTGEPAANDSSDDSDNEDVDSFASDSTQDYLTGH
Download sequence
Identical sequences G3STX9
ENSLAFP00000003561 ENSLAFP00000003561 XP_003420690.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]