SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003799 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003799
Domain Number 1 Region: 199-348
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-23
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.02e-21
Family First domain of FERM 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003799   Gene: ENSLAFG00000004552   Transcript: ENSLAFT00000004555
Sequence length 1025
Comment pep:novel supercontig:loxAfr3:scaffold_15:31348946:31551095:1 gene:ENSLAFG00000004552 transcript:ENSLAFT00000004555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEGRRCQVHLLDDRKLELLVQPKLLAKELLDLVASHFNLKEKEYFGIAFTDETGHLNWL
QLDRRVLEHDFPKKSGPVVLYFCVRFYIESISYLKDNATIELFFLNAKSCIYKELIDVDS
EVVFELASYILQEAKGDFSSNEVVRSDLKKLPALPTQALKEHPSLAYCEDRVIEHYKKLN
GQTRGQAIVNYMSIVESLPTYGVHYYAVKDKQGIPWWLGLSYKGIFQYDYHDKVKPRKIF
QWRQLENLYFREKKFSVEVHDPRRASVTRRTFGHSGIAVHTWYACPALIKSIWAMAISQH
QFYLDRKQSKSKIHAARSLSEIAIDLTETGTLKTSKLANMGSKGKIISGSSGSLLSSGSQ
ESDSSQSAKKDMLAALKSRQEALEETLRQRLEELKKLCLREAELTGKLPVEYPLDPGEEP
PIVRRRIGTAFKLDEQKILPKGEEAELERLEREFAIQSQITEAARRLASDPNVSKKLKKQ
RKTSYLNALKKLQEIENAINENRVKSGKKPTQRASLIIDDGNIASEDSSLSDALVLEDED
SQVTSTISPLQSPHKGLPPRPPSHNRPPPPQSLEGLRQMHYHRNDYDKSPIKPKMWSESS
LDEPYEKVKKRSSHGHSSSHKRFPSTGSCAEAGGGSSSLQNSPIRGLPHWNSQSSMPSTP
DLRVRSPHYVHSTRSVDISPTRLHSLALHFRHRSSSLESQGKLLGSENDTGSPDFYTPRT
RSSNGSDPMDDCSSCTSHSSSEHYYPAQMNPNYSTLAEDSPSKARERQRQRHKSAGNLVS
SNSGSMPNLAARNGAGPHGVYLHSQSQPSSQYRIKEYPLYIEGSATPVVVRSLENDQEGH
YSVKAQFKTSNSYTAGGMFKESWHGDEGDALRLTPSRSQIIRTPSLGREGAHDKGRAAVS
DELRQWYQRSTASHKEHSRLSHTSSTSSDSGSQYSTSSQSTFVAHSRVTRMPQMCKATSA
ALPQSQRSSTPSSEIGATPPSSPHHILTWQTGSYSDSCFLDSSLYPELADIQWYGQEKAK
PGTLV
Download sequence
Identical sequences G3SUG8
ENSLAFP00000003799 ENSLAFP00000003799 XP_010589021.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]