SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003844 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003844
Domain Number 1 Region: 289-595
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 7.45e-41
Family Galactose oxidase, central domain 0.013
Further Details:      
 
Domain Number 2 Region: 697-866
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-26
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 3 Region: 79-201
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-21
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1003-1049
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003844
Domain Number - Region: 49-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003844   Gene: ENSLAFG00000004601   Transcript: ENSLAFT00000004603
Sequence length 1369
Comment pep:novel supercontig:loxAfr3:scaffold_10:3325566:4021233:-1 gene:ENSLAFG00000004601 transcript:ENSLAFT00000004603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLESPGLWRTRPAGGGGGGSASSWLLDGHSWLLCYGFLYLALYAQVSQSKPCEKTGSCFS
GRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVL
RLRFNHFATECSWDHMYVYDGDSIYAPLIAVLSGLIVPEVRGNETVPEVVTTSGYALLHF
FSDAAYNLTGFNIFYSINSCPNNCSGHGKCTTSISVPSQVYCECDKYWKGEACDIPYCKA
NCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKAV
LHGKFMWVIGGYTFNYSSFQMVLNYNLESSIWNVGSLSRGPLQRYGHSLALYQENIFMYG
GRIETNDGNVTDELWVFNIHSQSWSTKSPTVLGHGQQYAVEGHSAHIMELDSRDVVMIII
FGYSAIYGYTSSIQEYHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKALP
GNKYGLVDDLYKYEVNTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAK
CFSADFLAYDIACDEWKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYK
PPNCKAFRDEEFCKNAGPGIKCIWNKNHCESWETGNTNNILRAKCPPKTSASDDRCYRYA
DCASCTANTNGCQWCDDKKCISANSNCSMTVKNYTKCHVRNEQICNKLTSCKSCSLNLNC
QWDQRQQECQALPAHLCGEGWSHIGDACLRINSSRESYDNAKLYCYNLSGNLASLTTPKE
VEFVLDEIHKYTQQKVSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCAFLE
RAAVAGLKANPCTSMADGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMWCSS
TKRCVDSNAYIISFPYGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGY
CIEGSSRGPMKLFGMHSNEMVLDTSLCPKEKYYEWSFIQCPACQCNGHSTCINNNVCEQC
KNLTTGKQCQECMPGYYGDPTNGGQCTACTCSGHANICHMHTGKCFCTTKGIKGDQCQLC
DSENRYVGNPLRGTCYYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNLDISINAS
NNFNLNITWSVGSTAGTISGEETPIVSKTNIKEYRDSFSYEKFNFRSNPNITFYVYVSNF
SWPIKIQIAFSQHNTIMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRREQLLRER
QQMASRPFASVDVALEVGAEQTDFLQGPLEGAPKPIAMEPCAGNRAAVLTVFLCLPRASS
GAPPPGQSGLAIASALIDISQQKPSDSKDKISGIRNRKHHLSTRQGTCV
Download sequence
Identical sequences G3SUK3
ENSLAFP00000003844 ENSLAFP00000003844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]