SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003869 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003869
Domain Number 1 Region: 25-187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003869   Gene: ENSLAFG00000004635   Transcript: ENSLAFT00000004635
Sequence length 196
Comment pep:novel supercontig:loxAfr3:scaffold_23:31462712:31529987:-1 gene:ENSLAFG00000004635 transcript:ENSLAFT00000004635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVFCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPL
HQNKSYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPA
NSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVDDSAILDCQFSEFYH
TPPPGFEKILFEQQIF
Download sequence
Identical sequences G1PHC7 G3SUM3 H0X8F6 L5KVK7 M3Z2U1 Q2T9X3 U6CPX3
ENSLAFP00000003869 ENSMLUP00000010073 9913.ENSBTAP00000025061 ENSMPUP00000017903 ENSMPUP00000017903 ENSLAFP00000003869 ENSBTAP00000025061 ENSOGAP00000011772 ENSMLUP00000010073 NP_001033295.1.59421 NP_001033295.1.76553 XP_003412673.1.64505 XP_003800764.1.62490 XP_004274659.1.21590 XP_004376625.1.4749 XP_004399526.1.74151 XP_004433728.1.5094 XP_004680299.1.23501 XP_004775293.1.14098 XP_006063623.1.26621 XP_006083613.1.53796 XP_006737149.1.47382 XP_006909075.1.64745 XP_007105372.1.24612 XP_007105373.1.24612 XP_007193795.1.59432 XP_007466481.1.90284 XP_008150302.1.99482 XP_010949730.1.22495 XP_010993482.1.51371 XP_011368621.1.92234 XP_011979909.1.54773 XP_015998588.1.101085 XP_017912209.1.57651 XP_019792190.1.83887 XP_019826872.1.53367 XP_020759656.1.74333 XP_021545118.1.83697 ENSOGAP00000011772 ENSBTAP00000025061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]