SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000003900 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000003900
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.81e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 136-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000474
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 222-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000754
Family EGF-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000003900
Domain Number - Region: 274-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000617
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000978
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000003900   Gene: ENSLAFG00000004671   Transcript: ENSLAFT00000004671
Sequence length 440
Comment pep:novel supercontig:loxAfr3:scaffold_50:2499174:2602705:-1 gene:ENSLAFG00000004671 transcript:ENSLAFT00000004671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSSACALFLLLLLLASPESRASQNCLNKQQLLTAIRQLQQLLKGQETRFTEGIRNMKS
RLAALQNSVSRATPDTPPVSCPALNAPLDGRKFGSKYLVNHEVHFTCNPGFQLIGPSSVV
CLPNGTWTGEQPQCRDISECSSQPCQNGGTCVEGVNQYRCICPPGRTGSRCQHQAQTATP
EGRVAGDPAFSRAPRCAQVERAQHCSCEAGFHLSGAATDDSICHDVNECELYRQEGRPRL
CMHACVNTPGSYRCACPSGYRSLADGKSCEDVNECVTSQHMCPQETMCINTGGGFQCVSP
ECPEGSGNVSYVKTSAFQCERNPCPMDSRPCRNMPKTISFHYLSLPSNLKTPITLFRMAT
ASAPGRPGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLD
RSFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences G3SUP8
ENSLAFP00000003900 ENSLAFP00000003900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]