SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004128 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004128
Domain Number 1 Region: 7-130
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0022
Further Details:      
 
Domain Number 2 Region: 257-365
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-20
Family Pleckstrin-homology domain (PH domain) 0.0069
Further Details:      
 
Domain Number 3 Region: 139-237
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004128   Gene: ENSLAFG00000004931   Transcript: ENSLAFT00000004930
Sequence length 383
Comment pep:novel supercontig:loxAfr3:scaffold_31:1603478:1624773:1 gene:ENSLAFG00000004931 transcript:ENSLAFT00000004930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDCERNKKRLLELLQRAGTGNAHCADCGEPDPDWASYKLGIFICLNCSGVHRNFPAISK
VKSVRLDFWEDSIVEVAVVLQFMTHNGNLRVKAKYEARVPAFYYVPQANDCLVLKEQWIR
AKYERQEFMADGKTISPPGNREGFLWKRGRDNAQFLKRRFVLLAREGLLKYYTKEEGKGP
KAVISIKDLNATFQTEKIGNPHGLQITYRREGHVRNLFVYHESGKEIVDWFNALRAARLQ
YLKMAFPELPESELVPLITRNYVKQGFMEKTGPKQTEPFKKRWFALDSQERRLLYYKNPL
DAFEQGQVFIGSNEQGYDIYEDLPKGIRGNHWKAGLTIVTPQRKFVFTCPTEKEQREWLR
SLRDVLYRPLTPLNHLSKTQGLG
Download sequence
Identical sequences G3SV76
ENSLAFP00000004128 ENSLAFP00000004128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]