SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004228 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004228
Domain Number 1 Region: 20-123
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 807-1087
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000467
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 3 Region: 144-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000158
Family Pentraxin (pentaxin) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004228   Gene: ENSLAFG00000005050   Transcript: ENSLAFT00000005053
Sequence length 1142
Comment pep:novel supercontig:loxAfr3:scaffold_0:16654844:16725881:-1 gene:ENSLAFG00000005050 transcript:ENSLAFT00000005053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLSFVWPAAWGCANCRVDLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFND
FDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNAS
YTRVAVSLRNQKVVLPQTLDAYQVSVAKSVSIPELSAFSLCFEATKIGNEDNDWTAFSYS
DASFTQLLSFGKDQRDYFLTISGLKCSLNSVLPVKENEDIFTESFEQLCIVWNNSLGSVG
VSFKRNYEIVPCDSTISKVIPGNGKLLLGSNQNEIASLKGDIYNFRLWNFTMNSKTLSNL
SCNVKGNVVDWQNDFWNIPTLALKAENNLSCGSYLIPLPAAELASCVDLGTLCQDGIVYR
ISIVIQNILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISLHLSTGEDKIKVRRSIEDD
SSQVVIWALLVYNATNNVSLEGKTIQQKLLRNNESLDEGLRLYTVNVRQLDICPADEDPK
GYLWPTTRPSEYILPCNGKPGFYASRTCHRNLTNASLAYWGVPDVSNCSNDLNNVNTILN
LTGEGQNLTSANITSIVEYVKRIVNNEENIDITLGSTLMTIFSNILTSSDSDLLESSSEA
LKTIDELAFKIDLTSTSRVNITTRNLALGVSSLPPGTNIVSNFSIGLPSNNESYFQMDFE
SGQVNPLASVILPPNLLENLSKEDSALVKRAQFTFFNKTGLFQDVGSQRDNLVSYVMACS
IGNITLQDLKDPVRIIIKHTRAQAVHHPICAFWDLNKNKGFGGWNTSGCIAYKGSDESET
VCLCNHLTHFGVLMDLQGTASQLDARNTKVLTFLTYIGCGISAIFSAATLLTYVAFEKLR
RDYPSKILMNLSTALLFLNLIFLLDGWITSFDVDGLCTAVAALLHFFLLATFTWMGLEAI
HMYIALVKVFNTYIRRYILKFCIIGWGLPALVVSVVLASRNQNEVYGKESYGKEQGDEFC
WIQDPVIFYVTCAGYFGVMFFLNVAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSL
TFLLGMTWGFAFFAWGPLNVPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGR
FRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTGE
SL
Download sequence
Identical sequences G3SVG3
ENSLAFP00000004228 ENSLAFP00000004228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]