SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004236 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004236
Domain Number 1 Region: 29-164
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.03e-44
Family Galectin (animal S-lectin) 0.00013
Further Details:      
 
Domain Number 2 Region: 194-328
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.89e-38
Family Galectin (animal S-lectin) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004236   Gene: ENSLAFG00000005065   Transcript: ENSLAFT00000005062
Sequence length 330
Comment pep:novel supercontig:loxAfr3:scaffold_16:35919712:35933422:1 gene:ENSLAFG00000005065 transcript:ENSLAFT00000005062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIPPTFPTHKNQPFGTRAVAQSVDITGVIPYVGTIPEQLEPGTLIVIRGHVPSDSDRFQV
DLQCGSSVKPRADVAFHLNPRFKRAGCIVCNTLISEKWGREDITYDMPFQREKSFEIVIM
VLKDKFQVAVNGKHTLLYAHRISLEKIDTLGIYGKVNIHSVAFRFSSDLQGTQASAVELI
QINRENVQRSGISQLTLPFAARLNSSMGPGRTVVIKGEVNTKAKASFNVDLVAGRSRDIA
LHLNPRLNIKAFVRNSFLQDSWGEEERNITSFPFSPGMYFEMIIYCDVKEFKVAINGVHS
LEYKHRFKELSNIDTLEIDGDINLLEVRSW
Download sequence
Identical sequences G3SVH0
ENSLAFP00000004236 ENSLAFP00000004236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]