SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004287 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004287
Domain Number 1 Region: 178-237
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000306
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 241-302
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000243
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 54-110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000607
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 4 Region: 115-176
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000675
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004287   Gene: ENSLAFG00000005120   Transcript: ENSLAFT00000005121
Sequence length 490
Comment pep:novel supercontig:loxAfr3:scaffold_16:50690144:50851073:1 gene:ENSLAFG00000005120 transcript:ENSLAFT00000005121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSHGDGFLEQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGLDDLNVCADPGI
PENGFRIPSEGVFFESSVTRFHCQDGFKLKGSTKRLCVKHLNGTLGWIPSDKTICVQEDC
RIPQIEDAEIHNKTYRHRDKLIVTCHEGFKIRYPDLYNMVSLCRDDGTWDNLPICQGCLR
PLASSNGYVNISEFQTSFPVGAVIAYHCFPGFKLDGSQYLECLHNLIWSSSPPRCLALEA
QVCPLPPMVSHGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
YCIKTEQTWPSTHETLLTTWKIVAFTATSVLLVLLLVILARMFQTKFKAHFPPRGPPRSS
SSDPDFVVVDGVPVMLPTYDEAVSSGLSALGPGYLASMGQGCPLPVDDQSPPAYPGSADM
DTAPGESETCDSASGSSELLQSLYSPPLGQGGAQPTSGNPDMMAGTAGEVASTSPGIDIA
DEIPLMEEDP
Download sequence
Identical sequences G3SVL4
ENSLAFP00000004287 ENSLAFP00000004287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]