SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004321 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004321
Domain Number 1 Region: 120-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.02e-40
Family Galectin (animal S-lectin) 0.00000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004321   Gene: ENSLAFG00000005163   Transcript: ENSLAFT00000005162
Sequence length 250
Comment pep:novel supercontig:loxAfr3:scaffold_9:30712361:30724289:1 gene:ENSLAFG00000005163 transcript:ENSLAFT00000005162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSFSLNDALSGPRNPNPQGWPGSWGNQPAGPGGYPGASYPGAYPGQGPPGAYPGQGPP
GAYPGQGPPGAAYPGPPAPGAYPSGPGPYPPPGQPPAPGAYPAANPFGSSAGPLAVTYDF
PFQEESCLAMLITILGTVKPNANRIALDFKRGNDVAFHFNPRFNENNRRVIVCNTKHDNV
WGREERQNVFPFESGKPFKIQVLAESDHFKVAVNDAHLLQYNHRMRNLREINKLGISGDI
ILTSASHAMM
Download sequence
Identical sequences G3SVP3
ENSLAFP00000004321 ENSLAFP00000004321 XP_003408709.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]