SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004352 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004352
Domain Number 1 Region: 52-104
Classification Level Classification E-value
Superfamily GLA-domain 3.2e-19
Family GLA-domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004352   Gene: ENSLAFG00000005201   Transcript: ENSLAFT00000005200
Sequence length 226
Comment pep:novel supercontig:loxAfr3:scaffold_21:16849909:16869456:-1 gene:ENSLAFG00000005201 transcript:ENSLAFT00000005200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKLLVLLSHLSIVTFAFPHCTSPKDPRHAKEEVFRSKEEANFFIHRRLLYNRFDLELFT
PGNLERECKEELCNYEEAREIFVDEDKTMKFWQEYSIKGPTTKSNDNREKIDVMGLLTGL
IAAGVLLVIFGLLGYYLCITKCNRQRHPSSSAVYVRRGRHTPSIIFRRPEETILSPSPPS
VEDTGLPSYEQAVALTRKHNVSPPPPYPGPTKGFRVFKKSMSLPSR
Download sequence
Identical sequences G3SVR5
ENSLAFP00000004352 XP_003412180.1.64505 ENSLAFP00000004352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]