SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004369 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004369
Domain Number 1 Region: 418-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.89e-79
Family Protein kinases, catalytic subunit 0.0000000372
Further Details:      
 
Domain Number 2 Region: 866-1008
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 3.4e-57
Family FAT domain of focal adhesion kinase 0.00000764
Further Details:      
 
Domain Number 3 Region: 138-256
Classification Level Classification E-value
Superfamily Second domain of FERM 7.85e-42
Family Second domain of FERM 0.000021
Further Details:      
 
Domain Number 4 Region: 37-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.2e-33
Family First domain of FERM 0.0004
Further Details:      
 
Domain Number 5 Region: 261-366
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-30
Family Third domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004369   Gene: ENSLAFG00000005217   Transcript: ENSLAFT00000005221
Sequence length 1011
Comment pep:novel supercontig:loxAfr3:scaffold_22:7659237:7743688:-1 gene:ENSLAFG00000005217 transcript:ENSLAFT00000005221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPIDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTIQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYER
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPRQMQENLKPKQFRKMIQQTFQQYAS
LKEEECIMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQVRSIRCLPLEEGQAVLQLGIEGAPQSLSIKTSSLAEAENMADLVDGYCRLQGEHKG
SLIVHPRKDGEKRNSLPQIPVLNLEDRRSHFSESCSIESDIYAEIPDETLRRPGGPQYGV
TRENVILGRILGEGFFGEVYEGVYQNHKGEQINVAIKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPIWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEEYYKAKASVTRLPIKWMSPESIN
FRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIEVLEKGDRLPKPDLCPPVLYTLM
TRCWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNARYRAPKILEPTAFQDPPPKPS
RPKYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHS
MREEDLIRPSSREEAQQLWEAERVKMRQMLDKQQKQMAEDYKWLRQEERSLDPMVYMNDK
SPLSPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLDLKNEL
CQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPPSSRTEIEGTQKLLNKDLAELINKMR
LAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
Download sequence
Identical sequences G3SVS7
ENSLAFP00000004369 ENSLAFP00000004369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]