SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004419 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004419
Domain Number 1 Region: 105-165
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000117
Family C-type lectin domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004419   Gene: ENSLAFG00000005278   Transcript: ENSLAFT00000005277
Sequence length 170
Comment pep:novel supercontig:loxAfr3:scaffold_1757:3057:5029:1 gene:ENSLAFG00000005278 transcript:ENSLAFT00000005277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQTVIYSDINLAKYPKRQQIKPESKNSSISDTEQDITYVELNLHNASQDLQGNDKKPH
CKVFPSPPGRLAAMTLGIICLVLLASVLITTVVVITADTVKPGQNNSSLITRTQKGRCHH
CPKAWFMYSNRCYYISNERKTWSESRMACASNASNLLHRDNEEDMVRFLS
Download sequence
Identical sequences G3SVX4
ENSLAFP00000004419 ENSLAFP00000004419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]