SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004696 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004696
Domain Number 1 Region: 58-207
Classification Level Classification E-value
Superfamily C-type lectin-like 6.82e-40
Family C-type lectin domain 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004696   Gene: ENSLAFG00000005594   Transcript: ENSLAFT00000005594
Sequence length 212
Comment pep:novel supercontig:loxAfr3:scaffold_114:1868578:1871532:-1 gene:ENSLAFG00000005594 transcript:ENSLAFT00000005594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARTARPSSLRVSGPGPCPLVLLLFFLPFITVLWWLSWSKRVSSTVPSNPLVQLQGLEHSK
QEEIYQKLTQLKAGVDCLCHPCFWEWTFFQGNCYFFSNSQWNWYDAITACQEVGAQLVVI
KTAEKQNFLQVQTSTSNLFTWIGLSDLKHEGIWHWVDGSSLLLSFMKYWNKGEPNSSGEE
KAEFRGEGWKDSKCDNSKFWICKTTAASCSSN
Download sequence
Identical sequences G3SWJ3
ENSLAFP00000004696 ENSLAFP00000004696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]