SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004752 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004752
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-26
Family Third domain of FERM 0.0062
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.0000283
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004752   Gene: ENSLAFG00000005663   Transcript: ENSLAFT00000005662
Sequence length 445
Comment pep:novel supercontig:loxAfr3:scaffold_44:12406414:12429277:-1 gene:ENSLAFG00000005663 transcript:ENSLAFT00000005662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLQCSPEQAVELN
ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIIAKHKELEGTSQASAEYQVLQIVS
AMENYGVEWHSVRNSEGQRLLIGVGPEGISICTDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAVTETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSDHSPPSSPLKSSESSMNC
SSCEGLSCQHTRALQEKLRKLKEAMLCMVCCGKEINSTFCPCGHTVCCESCAAQLQSCPV
CRSHVEHVQHVYLPTHPSLLILTML
Download sequence
Identical sequences G3SWN7
ENSLAFP00000004752 ENSLAFP00000004752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]