SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004798 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004798
Domain Number 1 Region: 187-366
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.17e-31
Family APC10-like 0.003
Further Details:      
 
Domain Number 2 Region: 1806-1865
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000412
Family ZZ domain 0.0093
Further Details:      
 
Domain Number 3 Region: 1762-1814
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000612
Family ZZ domain 0.02
Further Details:      
 
Domain Number 4 Region: 75-142
Classification Level Classification E-value
Superfamily EF-hand 0.00000418
Family Polcalcin 0.061
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000004798
Domain Number - Region: 1092-1178
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00157
Family Spermadhesin, CUB domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004798   Gene: ENSLAFG00000005715   Transcript: ENSLAFT00000005724
Sequence length 2925
Comment pep:novel supercontig:loxAfr3:scaffold_47:7637687:7756674:-1 gene:ENSLAFG00000005715 transcript:ENSLAFT00000005724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAPSYSSEDESAAAAGEAWGPRQDWAGESGTLLEPARLREAAAALRPTPPCESLVSRH
HGALLRWLEERLGRGEELVTLEQFRELLEARGAGCSGEQFEEAFAQFDAEGDGTVDAENM
LEALKNSSGANLQGELSHIIRQLQACSLVPGFVDIFSESKEGLGVHASMILRFLHRNRIS
STVIPYPMLDHCNNLCSMRSSVLKESLDQLLQKEKAETPGDLTGSPETDKLKSVAKCYSY
VETSSNPADADKMTNGETSSYWQSDGSSCSHWVRLKMKPDVVLRHLSIAVAATDLSYMPQ
QVTVAVGRTPSDLQEVRDVHIPSNVTGYVTLLENANISQLYVQINIKRCLRDGCDTRIHG
LRAVGFQKVKKSGVSVSDASAIWYWSLLTSLVTASMETNPAFVQTVLHNTQKALQHMPPL
SLSPGSTDFSTFLSPSVLEEVDSFLIRITSCCSTPEVELTLLAFALARGSVAKVMSSLCT
ITDHLDTQYDASSLISSMASVRQNLLLKYGKPLQLTLQACDVKGKEDKSGPENLLVEPWT
RDGFLTETGKTRASTIFSSGTESAFQVTQIRIMVRRGGIGAQCGLVFAYNSPSDKFHAEE
HFKRFEKYDKWKLQELRQFVKSRIGCSSDDLGEDDPIGWFELEEEWDEADVKLQQCRIAK
YLMVKFLCTRQESAERLGVQGLSISGYLRPARADTEQSVVCAHCRKDSEESVCGATLLLK
TLQFIQQLAHDLVQQKESGFKYKSFLDFAGLDLQIFWNFYNKLKQNPREECIYAQTLLLQ
LLQSCFSVLQGDAPVVSEKEKAPKQIPKGMEAAKELYTHLCDVVDRVSGDSAPMEILKQE
VRNTLLNGAAIFFPDRQTRRNHLFTMMKNVTEQEHKQSLQLTFRSLCTYFSDKDPGGLLL
LPEKSDLADMNIIEVLAVMNTLLSVAARECELLMPSGAQGEAGSVLFSLFWSVQGSLFSW
CYLQLKSTDTGAKDLAVDLIEKYVQQFLARMRVILESLLSQYSGKIIVEKLCNSVFSMAA
RQLVIFLLDFCTLDMPHCTLLREFSTLTELLKKLCSDPEGGLNKLDVETWQQEQPVVLHT
WTKESAHNYENNCHEVSVFVSPGATYFEVEFDERCETEKRYDYLEFTDARGGKTRYDTKV
GTEKWPRKVTFKAGPRLQFLFHSDSSNNEWGYKFTVTAYGLPDVAVSWGLDLQLLVSRLM
GRLASQCMALKSVHQLRSNMIVPQAKMVLVLNSPLWKPVFRHQICPELELEAYWTTPPHQ
DSKEVKNIPDSPCRNFLLDFSQSDPARDFCGPYSELFKGFIQACRKQAPKADIVAGSTID
QAVNATFAALVYRTPDLYEKLQKYVNSGGKIALSEEFAQVYSLADGIRIWMLEMKQRSLM
GLGNEAEEKLNSETTEANPESLSKECIQKSLLLLKFLPAGIHSKESCDQLVTAAETDSLQ
PPDKRQRTSSVVEEHFQASASPTEAAPPVAVDGRLGLDVQPKLLPSSGASTTEVSSATAE
EPSSPSTPTRRPAFTRGRLRLLSFRSMEEARPVPTIKEKYPVLKDVMDFIKDQSLSHDSV
VKVLSLKKAQAQSILEVLRIIQYCAESLGQPHCFHPPFILFLLELLTCQKEFTNYFGHLE
GCGAELHKEIRETYYQLVLFLVKAVEGFSSLNDRSLLPALSCVQTALLHLLDMGWEPSDL
AFFVSIQLPDLLMKMSQENISVHDSVISQWSEEDELADAKQNSEWMEECQDGMFEAWYEK
IAQEDPEKQRKMHMFIARYCGLLNVDISCDGCDEIAPWHRYRCLQCSDMDLCKTCFLGGV
KPEGHGDDHEMVNMEFACDHCRGLIIGRRMNCNVCDDFDLCYGCYAAKKYSYGHLPTHSI
TAHPMVTIRISDRQRLIQPYIHNYSWLLFAALALYSAHVASAEDVDGEKPDPQARSSATT
VQSQCVQLIGDCLMKAHQGKGLKALALLGMLPDGGSTPENQSLPVPLPTRTSGMLLEKKA
VQAAEEPSEAGAFVDCSGKGAAHKETRPLDCGQRGKAGEGVSLTKDPSCQTQTADSAADV
STPPGLPGAENSEPSPQKPVEEKAVTPSPEQVFAECSQKRILGLLAAMLPPLKSGPTVPL
IDQEHVLPLMFQAVISNAGHLNETYHLTLGLLGQLIVRLLPAEVDAAVTKVLSARPNLRV
GLDWACSMAEILRSLNSAPLWRDVIATFTDHCIKQLPFQLKHTNIFTLLVLVGFPQVLCV
GTRCVYMDNANEPHNVIVLFNFLKAGLNIMAGTEVRHRPSVKDYQLVQKGGEQEGSDSQA
QLSQYSQHFAFIVSHLLQTSMDTHCPEAVEATWVLSLALKGLYKTLKAHGFEETHATFLQ
TDVLKLLVKKCSKGTGFSKTWLLRDLEILSIMLYSSKKEMNILTEHGDPELTEQEDQEEE
AERSVSSPSETEQKKLDPLEGLDEPTRICFLMAHDALNAPLHVLRAIYELQMKRTESFFL
EVQKRFDGDELTTDERIRTLAQKWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCEQAT
AESNPVTQKLISSTESELQQSYAMQRRSKSAALLHKELNCKSKRAVRDYLFRVNEATAVL
YARHVLASLLAEWPGHMPVNEDVLELSGPAHMTYILDMLMQLEEKQQWEKILQKVLRGCR
ENMLGTMALTACQFMEEPGMEVQVRESKHPYNNNTNFEDKVHIPGAIYLSIKFDSQCNTE
EGCDELAMSSSSDFQQDRHNFSGSQQKWKDFELPGRDTLYYRFTSDMSNTEWGYKFTVTA
GHLGRFQTGFEILKQMLSEERVVPHLPLARIWEWLVGVACRQTGHQRLKAIHLLLKIVRC
CTHRDLCDLTLLKPLWKLFTQMEYSLSEDVTQPGILLPLHRALTELFFVTENRAQELGLL
QDYLLALTTDDHLLRCAAQALQNIAAISLAINYPNKATLLWNVEC
Download sequence
Identical sequences G3TYX7
ENSLAFP00000020785 ENSLAFP00000004798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]