SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004940 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004940
Domain Number 1 Region: 428-659
Classification Level Classification E-value
Superfamily GFP-like 5.96e-92
Family Domain G2 of nidogen-1 0.0000000014
Further Details:      
 
Domain Number 2 Region: 941-1177
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-48
Family YWTD domain 0.00000000123
Further Details:      
 
Domain Number 3 Region: 810-917
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.44e-24
Family Thyroglobulin type-1 domain 0.00054
Further Details:      
 
Domain Number 4 Region: 385-425,712-751,787-840
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000518
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 669-724
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000932
Family EGF-type module 0.07
Further Details:      
 
Domain Number 6 Region: 1206-1243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000004940
Domain Number - Region: 757-801
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0641
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004940   Gene: ENSLAFG00000005889   Transcript: ENSLAFT00000005891
Sequence length 1245
Comment pep:novel supercontig:loxAfr3:scaffold_16:35401389:35488878:-1 gene:ENSLAFG00000005889 transcript:ENSLAFT00000005891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARSSRSWAAWTRALLLQLLLAGPGGCLSRQELFPFGPGQGDRELEAGDDRVSPALLLS
GGLRFYDKSNIDSVYVTTNGIIAMSEPPAEESHPGLFPPTFGAIAPFLADLDTSDGLGKI
YYREDFSPSVTRLAAVCVQRGFPDVSFQPRSVVVVTWESVAPYEGPSRNPAQEGKRNTFQ
AVLASSDSSSYAIFLYPEDGLQFYTAYSKKDENQVPAVVAFSQGLMGIIWKTDGAYNIFA
NDRESIENLAKSSNSGQQGVWVFEIGSPATASGVIPADVDHGLDDGPEYEEEDEDYDPVM
RLGPEDVATTPFPYEALGRRDTDTYRVPSVLSPHHIATESPPELPTVKTRSFQLPVKRFP
QQHPQVIDVDEVEETGVVFSYNTDSRQTCANSRHQCSVHAECRDYTTGFCCSCVAGYTGN
GRQCVAEGSPQRVNGKVKGRIFVGNSQTPIVFENTDLHSYVVMNHGRSYTAISTIPETLG
YSLLPLAPVGGIIGWMFAVEQDGFKNGFSITGGEFTRQAEVTFVGHPGKLVIKQQFSGID
EHGHLTIDTELEGRVPQIAFGSSVHIEPYTELYHYSPSVITSSSTREYTVTEPERDGATP
SHTYTYQWRQTITFQQCTHDDARPALPSTQQLSVDSVFVLYNQDERILRYALSNSIGPVK
EGSPDALQNPCYIGSHGCDTNAACRPGPATQFFCECSIGFRGDGRTCQDIDECSEQPLVC
GRHAICNNHPGTFRCECEEGYRFSDEGTCVAVADQRPINYCTSGLHDCDIPQRAQCIYTG
GSSYSCSCLPGFSGDGRACQDVNECQPSRCHPDAFCYNTPGSFTCQCKPGYQGDGFRCMP
GEAEKTRCQQEREHILGAAGVDLQRPRPPGLFVPECDEHGHYAPTQCHGSTGHCWCVDWD
GREIEGTRTRPGTQPPCLSTVAPPTHHGPVVPTTVIPLPPGTHLLFAQTGKIEHLPLEGN
TMKKTEAKTLLHAPDKVIIGLAFDCVDKMVYWTDISGPSIGKASLHGGEPTTIIRQDLGS
PEGIALDHLGRNIFWTDSHLDRIEVAKLDGSQRRVLFETDLVNPRGIVTDSVRGNLYWTD
WNRDNPKIETAYMDGTNRRVLVKDDLGLPNGLTFDAFSSQLCWVDAGTKRVECISPDQPS
RRRILEGLQYPFAVTSYGKNLYYTDWKTNSVIAVDLAISKETDDFHPHKQTRPYGIITAL
SQCPQGHNYCSVNNGGCTHLCLATPGSRTCRCPDNTLGVDCIEQK
Download sequence
Identical sequences G3SX35
XP_003410954.1.64505 ENSLAFP00000004940 ENSLAFP00000004940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]