SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000004942 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000004942
Domain Number 1 Region: 223-382
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.62e-53
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000294
Further Details:      
 
Domain Number 2 Region: 10-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 3 Region: 123-220
Classification Level Classification E-value
Superfamily LCCL domain 1.23e-23
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000004942   Gene: ENSLAFG00000005891   Transcript: ENSLAFT00000005893
Sequence length 707
Comment pep:novel supercontig:loxAfr3:scaffold_66:789158:870624:-1 gene:ENSLAFG00000005891 transcript:ENSLAFT00000005893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDGCGYTILGAESGTLTSINYPQTYPNSTVCEWEIRVKVGERVRIKFGDFDIEDSDSCHF
NYLRIYNGIGVGRTEIGKYCGLGLQMNHTIESKSNEITVLFMSGIHVSGRGFLASYSVID
KQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTIPHGYRDSSPLCMAGVHAGVVSN
VLGGQISVVISKGIPYYESSLANNVTSVVGHLSTSLFTFKTSGCYGTLGMESGVIADSQI
TASSVLEWTDHTGQENSWKPEKARLKKPGPPWASFATDEYQWLQIDLNKEKKITGIITTG
STMVEHNYYVSAYRILYSDDGQRWTVYREPGVEQDKIFQGNKDYHQDVRNNFLPPIIARF
IRVNPTQWRQKIAMKMELLGCQFIPKGRPPKLTQAPPPRNSKDLKNTTAPPKIAKGRAPK
FTQPLQPRSSNEFPAQTEQTTATPDIKNTTVTPNVTKDVALAAVLVPVLVMVLTTLILIL
VCAWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKSVEHEETPVHYSSSEVNHLSPR
EVTTVLQTDAAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPVQEVYHAYAE
PLPITGPEYATPIVMDMSGHPAASVGLPSTSTFKATGNQPPPLVGTYNALLSRTDSCSSA
RAQYDTPKGGKPGPSAPDELVYQVPQSTQEVSGAGREGECDVFKEIL
Download sequence
Identical sequences G3SX37
ENSLAFP00000004942 ENSLAFP00000004942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]