SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005072 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005072
Domain Number 1 Region: 298-440
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 194-299
Classification Level Classification E-value
Superfamily Second domain of FERM 1.02e-36
Family Second domain of FERM 0.00000293
Further Details:      
 
Domain Number 3 Region: 113-193
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-27
Family First domain of FERM 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005072   Gene: ENSLAFG00000006036   Transcript: ENSLAFT00000006044
Sequence length 1078
Comment pep:novel supercontig:loxAfr3:scaffold_4:84646489:84758748:1 gene:ENSLAFG00000006036 transcript:ENSLAFT00000006044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTESGSDSESKQDQEAEPQEAAGPQGRAGAQPPGPSPEPAAEQQEAVEQFVAAAAHSTP
VRKEVTDKERDFAVEAAKQLEYQQLEDDKLSQKSSSSKLSRSPLKIVKKPRSMQCKVIVL
DGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPSKEIKKQIRS
GAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGSYTVQSEL
GDYDPDECGNDYVSEFRFAPNHTKELEDKVIELHKSHRGMTPAEAEMHFLENAKKLSMYG
VDLHHAKDSEGVEIMLGVCASGLLIYRDRLRINRFAWPKVLKISYKRNNFYIKIRPGEFE
QFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLLLPEAPPKKFLTLGSKFRYSGRTQAQTR
RASALIDRPAPYFERSSSKRYTMSRSLDGASVNENHEIYMKDSMSAAEVGTGQYATTKGI
SQTNLITTVTPEKKAEEERDEEEEHRKKAEEATPVAAVRHEGKKSPGLGTDPCPLSPPSA
HSPPASPTKLRRRCKEKDREAMGSQPCNDPVHVHGEPALEADGKGKPYLGDPDVACNYKQ
PAVRGTTLFSFSLQLPESFPSFLDDDGYLSFPNLSESNLLPQSLQHLAMCLCYLEPKAAS
LSASLDNDLSDSSEEETDSERTDTAADGETTATESDQEEDAELKAQELDKTQDDLMKHQT
NISELKRTFLETSTDTAITNEWEKRLSTSPVRLAARQEDAPMIEPLVPEETKQSSGEKLM
DSSEILSLLESARKPTEFIGGVTSTSQKWVQKMETKMGSSEIETEAAQHHQPLSTEKVVQ
ETVLVEERHVMSVHASGDASYAAGDDVDLAVQAAAEASSVKEKEGCALTERAKEEERELA
VRALPEQEEIATASQEQQEEQSVAVHISETLEQKPHFESSTVKTETISFGSVSPEGVKLE
ISTKEVPVVHTETKTITYESSQVDTGADLEPGVLMSAQTITSETTSTTTTTHITKTVKGG
ISETRIEKRIVITGDADIDHDQALAQAIKEAKEQHPDMSVTKVVVHKETEITPEDGED
Download sequence
Identical sequences G3SXE5
ENSLAFP00000005072 ENSLAFP00000005072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]