SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005142 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005142
Domain Number 1 Region: 239-266
Classification Level Classification E-value
Superfamily Moesin tail domain 0.000017
Family Moesin tail domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005142   Gene: ENSLAFG00000006133   Transcript: ENSLAFT00000006133
Sequence length 269
Comment pep:novel supercontig:loxAfr3:scaffold_3:70786735:70791873:1 gene:ENSLAFG00000006133 transcript:ENSLAFT00000006133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDIPVTYSGAECNGDTPPENGQQPITKITDETTNTSGTLPYYRVDPSLEDVPIKENQEK
SEKSQGNMLLNWSMDEKFLKEKPEENLFIVHKAITDLSLQETSADEPAFRGGHRWEKIPL
SSNNQEVIRQRDRICEKPLEEEDGDRKNKAHQATAIEWLGFQKPSQVDVLHSKDDEEQEG
WDEEKVRVIEFKKKSEEGSQLREEGNVSEDSPLSSPSSQPVTPDEHPTLGKKNDISRNAY
SRYNTISYRKIRKGNTKQRIDEFESMMHL
Download sequence
Identical sequences G3SXK3
ENSLAFP00000005142 ENSLAFP00000005142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]