SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005295 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005295
Domain Number 1 Region: 256-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000129
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 179-213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000137
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 243-367
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000152
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 217-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000005295
Domain Number - Region: 129-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0287
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005295   Gene: ENSLAFG00000006308   Transcript: ENSLAFT00000006308
Sequence length 493
Comment pep:novel supercontig:loxAfr3:scaffold_99:2811486:2817453:1 gene:ENSLAFG00000006308 transcript:ENSLAFT00000006308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLFLPFLLPQPNQGTFSLIIEIWKEELGEEIAGAAWSLLSRVAGRWRLEAGSPWARDVQR
AGGWELRFSYRARCEPPAVGAACTRLCRSRSAPSRCGPGQRPCAPMEEDCAAPLSLSLTV
ACRAGCSPEHGFCEQPNECQCLEGWAGPLCTVPVSTSSCLSPRGPSSATAGCLIPGPGPC
DGNPCANGGSCSETPGSFECACPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYV
CHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGYALRCRCRAGFAGPRCEHDLDDCAGR
ACANGGTCLEGGGARRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPG
YMGARCEFPVRPDGAEDGAGAPHAAPPGPRQGDPQRFLLPPALGLLVAASFAGAVLWLIH
LRRRGSGRDTGSRLLAGTPEPPTHSLPDALNNMRIREDPGDGPSLSADWSRPEDGDSRAI
YVISAPSIYAREV
Download sequence
Identical sequences G3SXX9
ENSLAFP00000005295 ENSLAFP00000005295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]