SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005330 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005330
Domain Number 1 Region: 424-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-74
Family Eukaryotic proteases 0.0000000586
Further Details:      
 
Domain Number 2 Region: 185-296
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00000165
Further Details:      
 
Domain Number 3 Region: 27-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-27
Family Spermadhesin, CUB domain 0.00000124
Further Details:      
 
Domain Number 4 Region: 367-437
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.0000129
Further Details:      
 
Domain Number 5 Region: 301-370
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0001
Further Details:      
 
Domain Number 6 Region: 136-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000067
Family EGF-type module 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005330   Gene: ENSLAFG00000006346   Transcript: ENSLAFT00000006346
Sequence length 687
Comment pep:novel supercontig:loxAfr3:scaffold_26:11118232:11133768:1 gene:ENSLAFG00000006346 transcript:ENSLAFT00000006346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLLIFLGLLCGTAASLPTPRWPKPVFGRLASPGFPGEYANEREHHWTLTAPPGYRLRLY
FTHFDLELSYLCEYDFVKLSSGAKVLATLCGRESTDTEQAPGNTIFYSPPGSSLEVTFHS
DYSNEKPFTGFEAFYAAEDIDECQVAPGEAPACDHHCHNYLGGYYCSCRPGYMLHQNKHT
CSALCSGQVFTERSGELSSPEYPKPYPKLSSCTYRIHLEEGFSVILDFVESFDVETHPET
QCPYDSLQIQTDKGEYGPFCGTTLPPRIETKSNSVTITFVSDQSGDHTGWKIHYMSTALP
CPNPMAPPNGRISPVQDRYTLKDRFSIFCETGYELLQGYLPLKSFTAVCQKDGSWDLPMP
GCSIVDCGPPEDLPNGQAEYITGPEVTTYKAVIQYSCKAKFYTMKMNDGKYVCEADGFWT
SSKGEKSLPVCEPVCGLSTRTTEGRIYGGQNAKLGDFPWQALLLGEATAAGALLYDDWIL
TAAHAVYRQKDDAFSLDIRMGALKRLSSNYTQAQAEAIFIHEGYIHNADFDNDIALIKLK
NKVAINSKIMPICLPRKAAESFMRTNDIGTASGWGLTQRGFLARNLMFVDIPIVDHQKCT
AAYEKKAYPGARVTHNMLCAGLESGGKDSCSGDSGGALVFLDNETQRWFVGGIVSWGSIN
CGEAKQYGVYTKVMNYIPWIKNIMGKY
Download sequence
Identical sequences G3SY05
ENSLAFP00000005330 ENSLAFP00000005330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]