SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005479 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005479
Domain Number 1 Region: 569-657
Classification Level Classification E-value
Superfamily PH domain-like 9.83e-19
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000785
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 533-568
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000222
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000005479
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0085
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005479   Gene: ENSLAFG00000006531   Transcript: ENSLAFT00000006530
Sequence length 680
Comment pep:novel supercontig:loxAfr3:scaffold_9:28412775:28509658:-1 gene:ENSLAFG00000006531 transcript:ENSLAFT00000006530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDGIRIPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDANDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQIATDINPECLVSPRYLKKYKNKQITARIL
EAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRLIRMDAST
GDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIFLSTRA
KDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences G3SYC5
ENSLAFP00000005479 XP_003408675.1.64505 ENSLAFP00000005479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]