SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005502 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005502
Domain Number 1 Region: 104-233
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-35
Family C-type lectin domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005502   Gene: ENSLAFG00000006555   Transcript: ENSLAFT00000006555
Sequence length 233
Comment pep:novel supercontig:loxAfr3:scaffold_15:54935322:54942883:1 gene:ENSLAFG00000006555 transcript:ENSLAFT00000006555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDEERYVTQNVQPKERSSVQTSQLKFKDCLVMLHWYKTLLGISGIVNCVLTLTLITLTR
LAFQGVLLQCPKENSPNITHEEEIGNLKVNSEARRNISNKDTDPCVSRTTGQTGLCPSEW
LKYQEKCYWFSNELKSWSDSYGYCSDRKSHLLIIQDQLEMAFIQKNLRQSNYVWIGLNVT
SLKKTWTWVDGSPLDPKLFVIKGPAEENSCAATKENKIYSETCSSVFKWICQY
Download sequence
Identical sequences G3SYE1
ENSLAFP00000005502 ENSLAFP00000005502 XP_003410729.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]