SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005545 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005545
Domain Number 1 Region: 282-424
Classification Level Classification E-value
Superfamily PH domain-like 7.38e-40
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 178-283
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-37
Family Second domain of FERM 0.00000422
Further Details:      
 
Domain Number 3 Region: 98-177
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005545   Gene: ENSLAFG00000006600   Transcript: ENSLAFT00000006604
Sequence length 880
Comment pep:novel supercontig:loxAfr3:scaffold_19:35323023:35371705:1 gene:ENSLAFG00000006600 transcript:ENSLAFT00000006604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTETGPDSEVKKAQEEAPQQPEAAAAVTTPVTPAGHGHPEANSNEKHLPQQETRPAEQS
LDMEEKDYSEADGLSERTTPSKAQKSPQKIAKKYKSAICRVTLLDASEYECEVEKHGRGQ
VLFDLVCEHLNLLEKDYFGLTFCDADSQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDP
AQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSEL
RFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIML
GVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSA
KRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERS
SSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKREEDGESGGRRSEADEGEVRTPTKIK
ELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERERRLPS
SPASPSPKGTPEKANERAGLREGSEEKVKPPRPRAPESDTGDEDQDQERDAVFLKDNHLA
IERKCSSITVSSTSSLEAEVDFTVIGDYHGSAFEDFSRSLPELDRDKSDSETEGLVFSRD
LSKGAPSQDDESVEIEDSPDRGACSTPDMPQFEPVKTETMTVSSLAIRKKIEPEAVLQTR
VATVDTTQVDGSAPGGKEFITTTPSITTETISTTMENSVKSGKGAAAMIPGPQTVATEIR
SLSPIIGKDVLTSTYGAIAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQA
LALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQVR
Download sequence
Identical sequences G3SYG8
ENSLAFP00000005545 ENSLAFP00000005545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]