SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000005821 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000005821
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 6.54e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 2 Region: 130-226
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.02e-17
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000005821   Gene: ENSLAFG00000006931   Transcript: ENSLAFT00000006932
Sequence length 760
Comment pep:novel supercontig:loxAfr3:scaffold_70:1270089:1325804:1 gene:ENSLAFG00000006931 transcript:ENSLAFT00000006932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKRLRSSEVCADCSGPDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYASRQGGHHELAERLVEIQYELTDRLAFYLCGRKP
DHKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWL
ATQNHSTLVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQG
SPLSSSKDNVELKLKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKANRQKSLDSD
LSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQA
TTTIYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEVNHPEESRT
RLQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESTRRASRLEKQNSTPESDYDNTPNDT
EPDDTGSSRKGRQRSMVWQGDSAAPNATEPHAAPSPSLPSTEDVIRKTEQITKNIQELLR
AAQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDLVRTSLRLLTSSAYRLQSECRKTLP
GDPGSPTDIQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
Download sequence
Identical sequences G3SZ51
ENSLAFP00000005821 ENSLAFP00000005821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]