SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006012 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006012
Domain Number 1 Region: 218-361
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-38
Family Third domain of FERM 0.0022
Further Details:      
 
Domain Number 2 Region: 115-220
Classification Level Classification E-value
Superfamily Second domain of FERM 2.36e-30
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 3 Region: 32-113
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.48e-26
Family First domain of FERM 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006012   Gene: ENSLAFG00000007148   Transcript: ENSLAFT00000007147
Sequence length 596
Comment pep:novel supercontig:loxAfr3:scaffold_6:8444727:8809350:1 gene:ENSLAFG00000007148 transcript:ENSLAFT00000007147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFASCHCVPRGRRTMKMIHFRSSSIKSLSQEMKCTIRLLDDSEISCHIQRETKGQFLIDH
ICNYYSLLEKDYFGIRYVDPEKQRHWLEPNKSIAKQMKSHPPYTMCFRVKFYPHEPLKIK
EELTRYLLYLQIKRDIFHGRLLCSFSDAAYLGACIVQAELGDYHPDEHPENYISEFEIFP
KQSQKLERKIVEIHKNELRGQSPPVAEFNLLLKAHALETYGVDPHPCKDSTGATTFLGFT
AAGFVVFQGNKRIHLIKWPDVSKLKFEGKTFYVIGTQKEKKAVLAFHTSTPAACKHLWKC
GVENQAFYKYAKSSQIKTVSSSKIFFKGSRFRYSGKVAKEVVEASSKIQREPPEVQRTNI
TQSRSSHSLNKQLIINMEPLQPLLPSPSEQEEELPLGEGVPLPKEDISAPLISSSPVKEA
RGYEDPPSEEEDKIKEEPLTISELAYNPSASLLPTPVDDDEIDMLFDCPSRLELEREDTD
SFEELEADENAFLIAEEEELKEARQALSWSYDILTGHIRVNPLVKSFSRLLVVGLGLLLF
VFPLLLLLLESGIDLSFLCEIRQTPEFEQFHYEFYCPLKEWVAGKVNLVLYMLGCS
Download sequence
Identical sequences G3SZG8
ENSLAFP00000006012 ENSLAFP00000006012 XP_003407865.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]