SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006026 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006026
Domain Number 1 Region: 39-156
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-29
Family C-type lectin domain 0.00000699
Further Details:      
 
Domain Number 2 Region: 253-319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000108
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 198-263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 159-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000645
Family EGF-type module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006026   Gene: ENSLAFG00000007162   Transcript: ENSLAFT00000007162
Sequence length 373
Comment pep:novel supercontig:loxAfr3:scaffold_33:24642722:24654918:1 gene:ENSLAFG00000007162 transcript:ENSLAFT00000007162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVFRWECESPRRGLWNVFKLWVWMVLSCDFMQRLGTHCWTYHYSETTMNWANARVFCQKY
YTDLIAIQNKQEIEYLGDTLPFRPTYYWIGIRKIHGVWTWVGTNKSLTEEAENWGDGEPN
NKKSKEDCVEIYIKRSKDKGKWNDDACHKAKTALCYTASCQPWSCSGHGECVEIINNYTC
NCDVGYYGPQCQFEVVQCKPLEAPELGIMACTHPLGDFSFSSQCIFNCSEGTNLIGIEET
TCGAFGNWSSLEPSCQVIQCEPLAAPDLGTMNCSHTLATFSFTSTCTFSCSEGTELIGEK
ETICGSSGIWSSPSPICQKLDRSISKIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLK
KGINSEKGMHSPC
Download sequence
Identical sequences G3SZI0
ENSLAFP00000006026 ENSLAFP00000006026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]