SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006032 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006032
Domain Number 1 Region: 30-172
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-32
Family C-type lectin domain 0.00000236
Further Details:      
 
Domain Number 2 Region: 249-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 373-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 309-383
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 430-497
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000459
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 6 Region: 495-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 7 Region: 187-252
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006032   Gene: ENSLAFG00000007166   Transcript: ENSLAFT00000007168
Sequence length 618
Comment pep:novel supercontig:loxAfr3:scaffold_33:24625529:24633507:1 gene:ENSLAFG00000007166 transcript:ENSLAFT00000007168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKTTLEVMIAGHFLSALSFAFLLVRDSGAWTYHTSVQTMTYDEAREYCQQYTDLVAIQNK
EEIKYLNSILSHSPSYYWIGIRKVNGVWTWVGTQKPLTPEAENWAPGEPNNKQNDEDCVE
IYIKRGKDEGMWNDESCNKKKLALCYTAACSNMSCSGHGECVETINNYTCECDPGFSGLN
CEQVVTCEAQKAPEHGSLVCTHPWGNFSYNSSCSVTCEKGHLPSSTEATRCTSSGEWSAP
TAACSVVECDALTSPADGTMKCSQSSGSFPWNTTCAFDCEEGFELMGVPSLQCTSSGNWD
NEMPTCKAVKCGAISGPQNGSMTCSHSPAGEFTFRSSCHFTCEQDFKLQGPAHVECSAQG
QWSQQTPICEALQCKALSNPERGYVNCLPGPSGSFQSGSSCEFSCEQGFVLKGPKRLQCG
RTGEWDGDKPTCEAVKCGAVSQPQHGSVRCTHSPTGELTYKSSCAFSCEEGFELRGSAQL
ECTSQGEWTQEVPSCQVVQCSSLAIPGKVNMSCSGEAVFGTVCRFACPEGWTLNGSAALT
CGATGHWSGMLPSCEAPTESSVPLGVGLSVAGTSLLTLGSFLFWLLKRLRKKARKFVPAS
SCQSLESDGTYQTENFDV
Download sequence
Identical sequences G3SZI6
ENSLAFP00000006032 ENSLAFP00000006032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]