SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006204 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006204
Domain Number 1 Region: 202-344
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-36
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 99-204
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-32
Family Second domain of FERM 0.0000885
Further Details:      
 
Domain Number 3 Region: 15-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000188
Family First domain of FERM 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006204   Gene: ENSLAFG00000007377   Transcript: ENSLAFT00000007377
Sequence length 568
Comment pep:novel supercontig:loxAfr3:scaffold_80:7741239:8078797:1 gene:ENSLAFG00000007377 transcript:ENSLAFT00000007377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSRLMSGSSRSLEREYSCTVRLLDDSEYTCTIQYPALGNPQFDLRCSLSLLVWEFANVR
FISRTRQRFILSHVRSLVYTLRSQPPFTMCFRVKFYPADPAALKEEITRYLVFLQIKRDL
YHGRLLCKTSDAALLAAYILQAEIGDYDPGKHPEGYSSKFQFFPKHSEKLERKIAEIHKT
ELSGQTPATSELNFLRKAQTLETYGVDPHPCKDVSGNAAFLAFTPFGFVVLQGNKRVHFI
KWNEVTKLKFEGKTFYLYVSQKEEKKIILTYFAPTPEACKHLWKCGIENQAFYKLEKSSQ
VRTVSSSNLFFKGSRFRYSGRVAKEVMESSAKIKREPPEIHRAGMVPSQSCPSITHGPRL
SSVPRTRRRAVHISIMEGLESLRDSAHSTPVRTSSHGDTFLPHVRSSRADSNERVAVIAD
EAYSPADSVLPTPVAEHSLELLLLSRQINGATCSIEEEESEASTPTATEVEALGGELRAL
CHGHSGPEEEQVNKFVLSVLRLLLVTMGLLFVLLLLLIILTESDLDIAFFRDIRQTPEFE
QFHYQYFCPLRRWFACKIRSMVSLLIDT
Download sequence
Identical sequences G3SZW2
ENSLAFP00000006204 ENSLAFP00000006204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]