SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006596 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006596
Domain Number 1 Region: 57-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000483
Family EGF-type module 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006596   Gene: ENSLAFG00000007856   Transcript: ENSLAFT00000007855
Sequence length 153
Comment pep:novel supercontig:loxAfr3:scaffold_30:23263215:23269313:-1 gene:ENSLAFG00000007856 transcript:ENSLAFT00000007855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGLPVSVYLLFNAMAAFTEEAAITVTPPITIQQSNWTVNKTEADYAEGPIALKFSPPC
LEDHNSYCINGVCAFHHELEKAICRCLTGYTGERCEHLTLTSYAMDSYEKYIAIGIGVGL
LLSSFLAMFYCYIRKRCLKLKLPYNICSGGRPL
Download sequence
Identical sequences G3T0S4
ENSLAFP00000006596 ENSLAFP00000006596 XP_010592439.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]