SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006682 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006682
Domain Number 1 Region: 810-918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-22
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 2 Region: 28-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-18
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 278-399
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.46e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 626-786
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000858
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 5 Region: 240-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000321
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 160-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000559
Family EGF-type module 0.018
Further Details:      
 
Domain Number 7 Region: 201-238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000724
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006682   Gene: ENSLAFG00000007965   Transcript: ENSLAFT00000007966
Sequence length 995
Comment pep:novel supercontig:loxAfr3:scaffold_105:623235:658140:-1 gene:ENSLAFG00000007965 transcript:ENSLAFT00000007966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGRVPGLCLLVLLVHARAAQHTKAVQDVDECVEGTDNCHIDAICQNTPRSYKCICKSG
YTGDGKHCKDVDECEREDNAGCVHDCVNIPGNYRCTCYDGFHLAHDGHNCLDVDECAEGN
GGCQQSCINMMGSYECHCREGFFLSDNQHTCIQRPEEGMNCMNKNHGCAHICRETPKGGI
ACECRPGFELTKNQRDCKLTCNYGNGGCQHTCDDTEQGPRCGCHVKFVLHTDGKTCIETC
AVNNGGCDSKCHDAATGVHCSCPVGFMLQPDRKTCKDIDECRLNNAGCDHICRNTVGSFE
CSCKKGYKLLINERNCQDIDECSFDRTCDHVCVNTPGSFQCFCHRGYLLYGVTHCGDVDE
CSINRGGCRFGCVNTPGSYQCTCPAGQGRLHWNGKDCTALEPVKCQGSPGASKAMLSCSR
SGKKDTCALSCPSQARFLPESENGFTVSCGTPSPRAAPARTSPTGNSTNSNQCHEAAALS
VKQRASFKIKDAKCRLHLRNKGKMEEASRMLGPGGAPCSDCQVTFIHLKCDSSRKGKGRR
ARTPPGKEVTRLTLELEAEVKAEESTAGCGLPCLRQRMERRLKGTLKMLRKSINQDRFLL
RLAGLDYELAHKSSPVAGERAELVETCRPGQHRAGAKCVSCPQGTYYHGQTEQCVPCPAG
TFQEREGQLSCDLCPGSDAHGPLGATNITTCAGQCPPGQHSIDGFKPCQPCPRGTYQPEA
GRTLCFPCGGGLTTKHEGAISFQDCDTKVQCSPGHYYNISVHRCIRCALGSYQPDFRQNF
CTRCPGNTSTDFDGSTSVAQCKNRQCGGELGEFTGYIESPNYPGNYPASVECVWNINPPP
KRKILIVVPEIFLPSEDECGDVLVMRKNSSPSSITTYETCQTYERPIAFTARSRKLWINF
KTSEANSARGFQIPYVTYDEDYEQLVEDIVRDGRLYASENHQEILKDKKLIKAFFEVLAH
PQNYFKYTEKHKEMLPKSFIKLLRSKVSSFLRPYK
Download sequence
Identical sequences G3T0Y2
ENSLAFP00000006682 ENSLAFP00000006682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]