SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000006819 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000006819
Domain Number 1 Region: 813-921
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-24
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 291-417
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-19
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 14-146
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.2e-16
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 255-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000619
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 186-229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000457
Family EGF-type module 0.023
Further Details:      
 
Domain Number 6 Region: 628-729
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000164
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number 7 Region: 693-810
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000549
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 8 Region: 145-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000006819   Gene: ENSLAFG00000008128   Transcript: ENSLAFT00000008132
Sequence length 999
Comment pep:novel supercontig:loxAfr3:scaffold_73:1685344:1855117:1 gene:ENSLAFG00000008128 transcript:ENSLAFT00000008132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLVGGGGKPRAVDVDECSEGTDDCHIDAICQNTLKSYKCLCKPGYKGEGRQCEDIDECEN
DYYNGGCVHECINIPGNYRCTCFDGFMLAQDGHNCLDVDECQDNNGGCQQICVNAMGSYE
CQCHSGFFLSDNQHTCIHRSNEGMNCMNKHHGCAHICRETPKGGVACDCRPGFDLAPNQK
DCTLTCNYGNGGCQHSCEDTDTGPMCGCHQKYALHTDGHTCIEKDEAAIERSQFNATSVA
DVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLTNN
GGCDHFCRNTVGSFECGCRKGYKLLTDERTCQDIDECSFERTCDHICINSPGSFQCLCHR
GYTLYGTTHCGDVDECSLNSGSCDQGCVNTKGSYECVCPPGRQLHWNRKDCVETGKCLSR
AKALPPAQLSCSKMGGADNCLLSCPAHTLFMPDSEDSYILSCGVPALQAKTSQKRNGTSS
SSEPSCSDAPVPPIKQKARFKIRDAKCHLRPRSRERAKEAPRQPLLDNCHVTFVTLKCDS
SKKRRRGRKSPSKEVSHITAEFEVETRMEEASDTCKADCLRKRAEQSLQAAIKTLRKSIS
RQQFYVQVSDTEYEVAQRPAKAMEGQGACSTGQVPQDGKCVSCEPGTYFGGEHSQCMPCT
PGTYQDVDGQLSCTPCPSNHGLGLPGARNVSECGGQCSAGFFSTDGFKPCQACPLGTYQP
EPGRTGCFPWGGGLVTKLESAHLPFQDCSTAVHCSPGHHYNTSTHRCIRCPVGTYQPEFG
QNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWYIS
PPPKRRILIVVPEIFLPIEDECGDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLW
IQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDV
LAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences G3T191
ENSLAFP00000006819 ENSLAFP00000006819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]